BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11g10 (702 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g44480.1 68416.m04781 disease resistance protein (TIR-NBS-LRR... 33 0.18 At1g17440.2 68414.m02133 transcription initiation factor IID (TF... 32 0.32 At1g17440.1 68414.m02132 transcription initiation factor IID (TF... 32 0.32 At5g45510.1 68418.m05590 leucine-rich repeat family protein cont... 29 3.9 At5g01570.1 68418.m00072 hypothetical protein hypothetical prote... 28 6.9 >At3g44480.1 68416.m04781 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1194 Score = 33.1 bits (72), Expect = 0.18 Identities = 35/121 (28%), Positives = 55/121 (45%), Gaps = 9/121 (7%) Frame = +3 Query: 207 NCNIASVSE-TMSDINQTK-LDTLEKKAVHLRL--VLEKDFKAADLKWSLFVAAAFSFRY 374 N N+ S+ ++D +Q K + LRL K+ + + WS A F Y Sbjct: 875 NINLKSLDTLNLTDCSQLKSFPEISTHISELRLKGTAIKEVPLSIMSWSPL--ADFQISY 932 Query: 375 ESCLRPFPPAF---MKSGI-KDMDELLSVITDVPAL-DLVLQQLDNLEALPNISDIIDLL 539 L FP AF K + KD+ E+ + + L DL L +NL +LP +SD +D + Sbjct: 933 FESLMEFPHAFDIITKLHLSKDIQEVPPWVKRMSRLRDLSLNNCNNLVSLPQLSDSLDYI 992 Query: 540 F 542 + Sbjct: 993 Y 993 >At1g17440.2 68414.m02133 transcription initiation factor IID (TFIID) subunit A family protein similar to SP|Q16514 Transcription initiation factor TFIID 20/15 kDa subunits (TAFII-20/TAFII-15) {Homo sapiens}; contains Pfam profile PF03847: Transcription initiation factor TFIID subunit A Length = 683 Score = 32.3 bits (70), Expect = 0.32 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +3 Query: 576 KTVPTDVHEQILAMANTMTTPSKPQ 650 KTVPTD+H++ LAM + SKP+ Sbjct: 610 KTVPTDLHKKRLAMVRALLESSKPE 634 >At1g17440.1 68414.m02132 transcription initiation factor IID (TFIID) subunit A family protein similar to SP|Q16514 Transcription initiation factor TFIID 20/15 kDa subunits (TAFII-20/TAFII-15) {Homo sapiens}; contains Pfam profile PF03847: Transcription initiation factor TFIID subunit A Length = 683 Score = 32.3 bits (70), Expect = 0.32 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +3 Query: 576 KTVPTDVHEQILAMANTMTTPSKPQ 650 KTVPTD+H++ LAM + SKP+ Sbjct: 610 KTVPTDLHKKRLAMVRALLESSKPE 634 >At5g45510.1 68418.m05590 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 1222 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/38 (36%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = +3 Query: 426 DMDELLSVITDVPAL-DLVLQQLDNLEALPNISDIIDL 536 ++ EL + I D+ +L +L+L+ NL+A+PNI + +L Sbjct: 871 NLSELATTIEDLSSLNELLLRDCINLDAIPNIEKLENL 908 >At5g01570.1 68418.m00072 hypothetical protein hypothetical protein T16O11.19 - Arabidopsis thaliana, EMBL:AC010871 Length = 157 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +3 Query: 432 DELLSVITDVPALDLVLQQLDNLEALP 512 DEL+ V+ D D+++Q L+ L A+P Sbjct: 16 DELIHVLDDRKGFDVLVQTLEQLRAIP 42 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,898,761 Number of Sequences: 28952 Number of extensions: 278328 Number of successful extensions: 671 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 657 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 671 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -