BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11g09 (656 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 23 3.4 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 22 5.9 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 22 5.9 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 22 5.9 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 22 5.9 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 22 5.9 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 7.8 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 22.6 bits (46), Expect = 3.4 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +3 Query: 219 KNSENAYADNMEVNGSNRCSWRRLDGFYDVCQKRKTG 329 K E A N++V G+ G YD+ KR+ G Sbjct: 295 KLEEIAGKFNLQVRGTRGEHTEAEGGIYDISNKRRLG 331 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -2 Query: 157 LDSVAWNSFYYFNSFMLPW 101 ++ V N++YY+ MLP+ Sbjct: 225 MEDVELNAYYYYMREMLPY 243 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -2 Query: 157 LDSVAWNSFYYFNSFMLPW 101 ++ V N++YY+ MLP+ Sbjct: 225 MEDVELNAYYYYMREMLPY 243 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +1 Query: 442 WMLIYFGFTHCPDICPDE 495 + L+Y CPD CP + Sbjct: 343 FFLMYVIVPFCPDCCPSD 360 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +1 Query: 442 WMLIYFGFTHCPDICPDE 495 + L+Y CPD CP + Sbjct: 343 FFLMYVIVPFCPDCCPSD 360 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +1 Query: 442 WMLIYFGFTHCPDICPDE 495 + L+Y CPD CP + Sbjct: 343 FFLMYVIVPFCPDCCPSD 360 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +1 Query: 556 QPVFISVDPQRDTPELVGKYCKEFTPRLLG 645 +P++ ++ P V YC F PR +G Sbjct: 332 KPLYYNIINIEQIPVPVPIYCGNFPPRPMG 361 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,394 Number of Sequences: 438 Number of extensions: 3831 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -