BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11g07 (706 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT022674-1|AAY55090.1| 133|Drosophila melanogaster IP07123p pro... 47 3e-05 AE014296-725|AAF47817.1| 178|Drosophila melanogaster CG14984-PA... 47 3e-05 BT001805-1|AAN71560.1| 134|Drosophila melanogaster RH30067p pro... 31 2.0 >BT022674-1|AAY55090.1| 133|Drosophila melanogaster IP07123p protein. Length = 133 Score = 46.8 bits (106), Expect = 3e-05 Identities = 24/38 (63%), Positives = 27/38 (71%) Frame = +2 Query: 146 EARPKWQFLPQAPGYVPVYIRSGDTPLEEINPDLAEAF 259 EA P +Q L G+VPVYIR GD PL EI+P LAEAF Sbjct: 47 EAAP-FQELEPRKGHVPVYIRHGDEPLSEIHPGLAEAF 83 >AE014296-725|AAF47817.1| 178|Drosophila melanogaster CG14984-PA protein. Length = 178 Score = 46.8 bits (106), Expect = 3e-05 Identities = 24/38 (63%), Positives = 27/38 (71%) Frame = +2 Query: 146 EARPKWQFLPQAPGYVPVYIRSGDTPLEEINPDLAEAF 259 EA P +Q L G+VPVYIR GD PL EI+P LAEAF Sbjct: 92 EAAP-FQELEPRKGHVPVYIRHGDEPLSEIHPGLAEAF 128 >BT001805-1|AAN71560.1| 134|Drosophila melanogaster RH30067p protein. Length = 134 Score = 30.7 bits (66), Expect = 2.0 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = +3 Query: 255 LSTLCPPEEALVKMSKQPQKFPNTTHQNLMCPKTQKLVIAALK 383 LS +C P+E LVK+S Q K +T +Q+L T+ + A K Sbjct: 62 LSLVCHPDEQLVKLSVQEAKERSTRNQDLDETTTEHVYFAHRK 104 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,487,612 Number of Sequences: 53049 Number of extensions: 545362 Number of successful extensions: 1311 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1241 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1311 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3108380451 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -