BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11g06 (607 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_51035| Best HMM Match : Extensin_2 (HMM E-Value=0.33) 35 0.044 SB_9163| Best HMM Match : XS (HMM E-Value=0.84) 33 0.14 SB_37043| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.00036) 32 0.31 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.55 SB_40275| Best HMM Match : Cadherin (HMM E-Value=0) 31 0.72 SB_25996| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_32584| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_27495| Best HMM Match : VWA (HMM E-Value=0) 28 6.7 SB_41161| Best HMM Match : TSP_1 (HMM E-Value=6e-22) 28 6.7 SB_48964| Best HMM Match : TRAP_240kDa (HMM E-Value=0) 27 8.9 SB_42355| Best HMM Match : EGF (HMM E-Value=2.9e-05) 27 8.9 SB_15991| Best HMM Match : SCP (HMM E-Value=2.3e-23) 27 8.9 SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 35.5 bits (78), Expect = 0.034 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = +1 Query: 76 CPPVCSPPDCRPICGPASPLLCQSSVPP 159 CP CSP CRP C PL+C S PP Sbjct: 1669 CPATCSPDSCRPEC----PLICCSVCPP 1692 Score = 31.9 bits (69), Expect = 0.41 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +1 Query: 79 PPVCSPPDCRPICGPASPLLCQSSVPPTQRC 171 PPV P C C P P++C + P C Sbjct: 1795 PPVVCPKSCETTCTPDCPVMCCKNSSPATEC 1825 Score = 25.8 bits (54), Expect(2) = 4.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 70 GYCPPVCSPPDCRPIC 117 G CP C P +C+P C Sbjct: 1456 GECPAGCLPSNCKPDC 1471 Score = 21.0 bits (42), Expect(2) = 4.0 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = +1 Query: 94 PPDCRPICGPASPLLC 141 P DC C P P+ C Sbjct: 1494 PSDCFESCKPNCPIKC 1509 >SB_51035| Best HMM Match : Extensin_2 (HMM E-Value=0.33) Length = 321 Score = 35.1 bits (77), Expect = 0.044 Identities = 17/35 (48%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +1 Query: 73 YCPPVCSPPDCRPICGPASPLL--CQSSVPPTQRC 171 Y PP +P C P C P SP+ CQSS PT+ C Sbjct: 285 YQPPPMAPMGCAPQCSPVSPMFMGCQSSC-PTRCC 318 >SB_9163| Best HMM Match : XS (HMM E-Value=0.84) Length = 424 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 70 GYCPPVCSPPDCRPICGPASPLLCQSSVPP 159 G C P C+P C P+C ++ LL Q+ +PP Sbjct: 302 GSCLPACAP-GCNPLCCSSTSLLHQNRIPP 330 >SB_37043| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.00036) Length = 1336 Score = 32.3 bits (70), Expect = 0.31 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 112 ICGPASPLLCQSSVPPTQRCY 174 +CG + LLC+ VPP RCY Sbjct: 555 VCGESKCLLCKEMVPPDHRCY 575 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 31.5 bits (68), Expect = 0.55 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 79 PPVCSPPDCRPICGPASPLLCQSSVP 156 PP PP C P+C A+P C ++ P Sbjct: 1518 PPAPPPPVCMPMCAVAAPAPCPAACP 1543 >SB_40275| Best HMM Match : Cadherin (HMM E-Value=0) Length = 1747 Score = 31.1 bits (67), Expect = 0.72 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 136 LCQSSVPPTQRCYPVNPCINIYSCYTQI 219 L ++ PP +RC P NPC++ CY + Sbjct: 988 LYEAVFPPEKRCKPHNPCLHGGKCYETV 1015 >SB_25996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 429 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = +1 Query: 43 VYKLKK*KMGYCPPVCSPPDCRPICGPASPLLCQSSVPPTQRCYPVNPCINI 198 +Y+ K C PV + C P+ P+ S P C PVN C+N+ Sbjct: 112 IYREDKPVNNSCEPVNN--SCEPVNNSCEPVN-NSCEPVNNSCEPVNNCVNM 160 >SB_32584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 665 Score = 27.9 bits (59), Expect = 6.7 Identities = 10/45 (22%), Positives = 22/45 (48%) Frame = +3 Query: 387 IARLIYHVKIFYINYEQIIAICFYFGILMSFDFMYIYSYVSTVEF 521 I L+YH+ F +N A+C + + F + + +++ + F Sbjct: 452 ITMLLYHLLYFLVNQSDTRALCVAVAVSLHFALLSAFCWMNVLAF 496 >SB_27495| Best HMM Match : VWA (HMM E-Value=0) Length = 1064 Score = 27.9 bits (59), Expect = 6.7 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +1 Query: 94 PPDCRPICGPASPLLCQSSVPPTQR 168 P C+P+ P P++C+ ++P R Sbjct: 795 PGKCKPVESPVDPVICRGTLPNPSR 819 >SB_41161| Best HMM Match : TSP_1 (HMM E-Value=6e-22) Length = 649 Score = 27.9 bits (59), Expect = 6.7 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -2 Query: 264 KTFLNSL*KSSIALHNLSVTAVYVDARIYRIAPLCWW 154 K F+ ++ K S+ +H L+ + DAR R PL W+ Sbjct: 10 KAFVGNIDKDSVKIHWLTK---FFDARFVRFYPLAWY 43 >SB_48964| Best HMM Match : TRAP_240kDa (HMM E-Value=0) Length = 1227 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = +1 Query: 82 PVCSPPDCRPICGPA--SPLLCQSSVPPTQRCYP 177 P+ +P+ GPA SP+ C ++VP C P Sbjct: 764 PISRVSPFQPVTGPAAPSPVPCNTTVPSAVACVP 797 >SB_42355| Best HMM Match : EGF (HMM E-Value=2.9e-05) Length = 241 Score = 27.5 bits (58), Expect = 8.9 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 7/40 (17%) Frame = +1 Query: 115 CGPASPLLCQSS-------VPPTQRCYPVNPCINIYSCYT 213 C P SP C S VP C+ NPC N SC T Sbjct: 135 CVPGSPENCVSDAKWHQYVVPTKDECFTGNPCKNGGSCVT 174 >SB_15991| Best HMM Match : SCP (HMM E-Value=2.3e-23) Length = 1189 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +1 Query: 94 PPDCRPICGPASPLLCQSSVPPTQRC 171 P DC C P C S+ PPT +C Sbjct: 935 PSDCHFSCYPQCTPECCSTTPPTAQC 960 >SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/38 (31%), Positives = 15/38 (39%) Frame = +1 Query: 76 CPPVCSPPDCRPICGPASPLLCQSSVPPTQRCYPVNPC 189 CP C P P+ P +P L + PP PC Sbjct: 18 CPTPCYGPVPHPLLRPCAPPLATALSPPPATALCPTPC 55 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,377,945 Number of Sequences: 59808 Number of extensions: 329639 Number of successful extensions: 855 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 772 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 851 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1475788250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -