BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11g04 (707 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56841| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 2e-20 SB_7420| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 29 2.8 SB_55463| Best HMM Match : OPA3 (HMM E-Value=0) 29 3.7 SB_16619| Best HMM Match : Dynamitin (HMM E-Value=1.1) 29 4.9 SB_13208| Best HMM Match : ThiS (HMM E-Value=1.6) 29 4.9 SB_51137| Best HMM Match : Fibrinogen_C (HMM E-Value=0.23) 28 6.5 SB_23298| Best HMM Match : MdcD (HMM E-Value=3.9) 28 6.5 SB_56175| Best HMM Match : RRM_1 (HMM E-Value=0.27) 28 8.5 SB_12927| Best HMM Match : ATP-synt_A (HMM E-Value=4.3) 28 8.5 >SB_56841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 340 Score = 96.3 bits (229), Expect = 2e-20 Identities = 63/164 (38%), Positives = 83/164 (50%), Gaps = 21/164 (12%) Frame = +3 Query: 276 EFVDIEAKFYSEVHAXXXXXXXXXXXXXXXRALIVNGTYEPNDDECLNPW----RDDTEE 443 E +E KFY EVHA R I +G EP D+EC P D+ EE Sbjct: 141 ECCKLEGKFYEEVHALECKYAEKFKPFYEKRRNIASGGVEPTDEECRWPSDAEDEDEAEE 200 Query: 444 EELARAVQNAAIT-EGEEK---KDDKAIEPPMDP-NVKGIPDFWYNIFRNVSMLSEMMQE 608 +E A + + ++ E EEK D++ IE P + KGIP+FW +NV +LSEM+QE Sbjct: 201 KEEKEATEVSKLSGEVEEKVKIDDEEKIETEQLPEDTKGIPEFWLTAMKNVELLSEMIQE 260 Query: 609 HDEPILKCLQDIKV------------QMHEDPISFTLEFYFAPN 704 HDEPILK L D++V P+ F LEF+F PN Sbjct: 261 HDEPILKHLHDVRVIFTGPESTNTTQYPQPTPMGFVLEFHFTPN 304 >SB_7420| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 1354 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +3 Query: 507 KAIEPPMDPNVKGIPDFWYNIFRNVSMLSEMMQEHDE 617 + I+PP+ P K +PD ++ R + LS + EH+E Sbjct: 156 RKIKPPVPPKPKVMPDRAASLSRQSASLSRRIPEHNE 192 >SB_55463| Best HMM Match : OPA3 (HMM E-Value=0) Length = 387 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Frame = +3 Query: 423 WRDDTEEEELARAVQNAAITEGEEKKDDKAIEPPMDPNVKG-IPDFWYNIFRNVSMLSEM 599 +R ++EE A QN+ I + + D I N+KG + D W I + S L + Sbjct: 215 YRRSAKKEEQKEAAQNSKILALQSQVSDLGIAMEAGLNIKGEVTDGWNEIKKAASGLRYI 274 Query: 600 MQEHDE 617 + + DE Sbjct: 275 IFKMDE 280 >SB_16619| Best HMM Match : Dynamitin (HMM E-Value=1.1) Length = 667 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 Query: 228 VGMPSLLHEGDL*WPLSFHYGSRHFSTGVALVH 130 V +PS +HE D PL F +GS + T + L H Sbjct: 207 VPLPSSIHEADDMLPLCFEFGSLNSQTLLMLEH 239 >SB_13208| Best HMM Match : ThiS (HMM E-Value=1.6) Length = 1119 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 3/37 (8%) Frame = +3 Query: 477 ITEGEEKKDDKA-IEPPMDPNV--KGIPDFWYNIFRN 578 +TE +E+K+DKA IE P + + ++YN FRN Sbjct: 371 VTENKEEKEDKAKIEDSQTPEIFSHSLDLYFYNEFRN 407 >SB_51137| Best HMM Match : Fibrinogen_C (HMM E-Value=0.23) Length = 365 Score = 28.3 bits (60), Expect = 6.5 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +3 Query: 387 TYEPNDDECLNPWRDDTEEEEL 452 TYE D+ C +PW+D +++ E+ Sbjct: 268 TYERLDNSCTSPWQDVSQKSEV 289 >SB_23298| Best HMM Match : MdcD (HMM E-Value=3.9) Length = 238 Score = 28.3 bits (60), Expect = 6.5 Identities = 15/64 (23%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Frame = +3 Query: 423 WRDDTEEEELARAVQNAAITEGEEKKDDKAIEPPMDPNVKGIP-DFWYNIFRNVSMLSEM 599 W+ E R ++NA + + K+ KA++P +D + P Y + + +EM Sbjct: 38 WKLPIPAELTTRTIRNAQVWYQDTSKETKAVDPSLDSSSSSEPMQQLYLQQQQIKTAAEM 97 Query: 600 MQEH 611 + H Sbjct: 98 EKNH 101 >SB_56175| Best HMM Match : RRM_1 (HMM E-Value=0.27) Length = 601 Score = 27.9 bits (59), Expect = 8.5 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +3 Query: 390 YEPNDDECLNPWRDD-TEEEELARAVQNAAITE 485 + N D+C+N + T + EL R +QNAA TE Sbjct: 468 HNANSDDCINNRGEPYTTKAELVRILQNAAETE 500 >SB_12927| Best HMM Match : ATP-synt_A (HMM E-Value=4.3) Length = 477 Score = 27.9 bits (59), Expect = 8.5 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -1 Query: 449 LFFFSVITPWVETFIIIRFICAIHNKSSLFIKRLVKFFIFAFECMYF 309 LFF +T +F + FI + F K + F++ F CMYF Sbjct: 13 LFFLLFLTV---SFHVFMFIVVPYVTKRPFFKNIPAIFMYIFMCMYF 56 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,434,438 Number of Sequences: 59808 Number of extensions: 440301 Number of successful extensions: 1175 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1078 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1167 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1865706635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -