BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11g03 (612 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77740.1 68414.m09051 1-phosphatidylinositol-4-phosphate 5-ki... 30 1.4 At4g36730.2 68417.m05212 G-box binding factor 1 (GBF1) identical... 29 3.2 At4g36730.1 68417.m05211 G-box binding factor 1 (GBF1) identical... 29 3.2 At5g24460.1 68418.m02883 expressed protein 27 9.8 At2g26420.1 68415.m03170 1-phosphatidylinositol-4-phosphate 5-ki... 27 9.8 >At1g77740.1 68414.m09051 1-phosphatidylinositol-4-phosphate 5-kinase, putative / PIP kinase, putative / PtdIns(4)P-5-kinase, putative / diphosphoinositide kinase, putative strong similarity to phosphatidylinositol-4-phosphate 5-kinase AtPIP5K1 [Arabidopsis thaliana] GI:3702691; contains Pfam profiles PF01504: Phosphatidylinositol-4-phosphate 5-Kinase, PF02493: MORN repeat Length = 754 Score = 29.9 bits (64), Expect = 1.4 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +3 Query: 246 RFTGASQNGVAVECGRHSWSEAATWMAAW 332 R+ G +NGV G +W++ ++W+ +W Sbjct: 219 RYEGQWENGVPKGSGVFTWADGSSWIGSW 247 >At4g36730.2 68417.m05212 G-box binding factor 1 (GBF1) identical to G-box binding factor 1 SP:P42774 from [Arabidopsis thaliana]; contains Pfam profile: PF00170 bZIP transcription factor Length = 313 Score = 28.7 bits (61), Expect = 3.2 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -3 Query: 514 PFSVLLKLASVREVHPAPNPLLQSQHQAYY 425 PF +S +EV P P P Q+ QAYY Sbjct: 9 PFKTTKPTSSAQEVPPTPYPDWQNSMQAYY 38 >At4g36730.1 68417.m05211 G-box binding factor 1 (GBF1) identical to G-box binding factor 1 SP:P42774 from [Arabidopsis thaliana]; contains Pfam profile: PF00170 bZIP transcription factor Length = 315 Score = 28.7 bits (61), Expect = 3.2 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -3 Query: 514 PFSVLLKLASVREVHPAPNPLLQSQHQAYY 425 PF +S +EV P P P Q+ QAYY Sbjct: 9 PFKTTKPTSSAQEVPPTPYPDWQNSMQAYY 38 >At5g24460.1 68418.m02883 expressed protein Length = 300 Score = 27.1 bits (57), Expect = 9.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 251 KPGLKNMHGLWPMTTPG*TS 192 KPG KN+H LW + G TS Sbjct: 113 KPGTKNVHNLWLELSDGETS 132 >At2g26420.1 68415.m03170 1-phosphatidylinositol-4-phosphate 5-kinase, putative / PIP kinase, putative / PtdIns(4)P-5-kinase, putative / diphosphoinositide kinase, putative similar to phosphatidylinositol-4-phosphate 5-kinase AtPIP5K1 [Arabidopsis thaliana] GI:3702691; contains Pfam profiles PF01504: Phosphatidylinositol-4-phosphate 5-Kinase, PF02493: MORN repeat Length = 705 Score = 27.1 bits (57), Expect = 9.8 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +3 Query: 246 RFTGASQNGVAVECGRHSWSEAATWMAAWGHW*KRCENDDV 368 R+ G +NG V G SW E T WG K+ + + V Sbjct: 195 RYDGLWENGAPVGKGVLSWGEEKTSYNGWGRKSKKKDEEIV 235 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,841,011 Number of Sequences: 28952 Number of extensions: 199895 Number of successful extensions: 514 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 514 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1226538000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -