BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11g01 (740 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33392| Best HMM Match : zf-CCHC (HMM E-Value=0.043) 30 1.7 SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_22256| Best HMM Match : zf-CCHC (HMM E-Value=0.0025) 29 3.0 SB_11191| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_13237| Best HMM Match : zf-CCHC (HMM E-Value=0.0076) 28 6.9 SB_1753| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_12488| Best HMM Match : PAN (HMM E-Value=0.0087) 28 9.1 SB_7017| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 >SB_33392| Best HMM Match : zf-CCHC (HMM E-Value=0.043) Length = 348 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/47 (34%), Positives = 21/47 (44%) Frame = +1 Query: 253 CLEFGHWSYECKGKRKILVRPSRTRIMHKNLKAKEEGQCSNGSCKIP 393 CL+ GH EC+ K+K + PS H L A +N IP Sbjct: 20 CLKRGHPQRECRSKKKCEIVPSCPYFHHPLLHAHSPPASANAVTPIP 66 >SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 226 FPQGIRCQKCLEFGHWSYEC 285 +P RC +C E GH SYEC Sbjct: 101 YPDKSRCYECGEGGHLSYEC 120 >SB_22256| Best HMM Match : zf-CCHC (HMM E-Value=0.0025) Length = 238 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +1 Query: 244 CQKCLEFGHWSYECKGKRKILVRPSRTRIMHKNLKA 351 C CL+ GH EC+ K+K + PS H L A Sbjct: 19 CFSCLKRGHPQRECRSKKKCEIVPSCPYFPHPLLHA 54 >SB_11191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1577 Score = 29.5 bits (63), Expect = 3.0 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +1 Query: 241 RCQKCLEFGHWSYECKGK 294 RC +CL H SYECK K Sbjct: 357 RCFRCLRKNHRSYECKSK 374 >SB_13237| Best HMM Match : zf-CCHC (HMM E-Value=0.0076) Length = 558 Score = 28.3 bits (60), Expect = 6.9 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +1 Query: 232 QGIRCQKCLEFGHWSYECKGKR 297 +G +C KC + GH++ CKG++ Sbjct: 41 RGKKCAKCFKSGHFAACCKGEK 62 >SB_1753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 377 Score = 27.9 bits (59), Expect = 9.1 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -2 Query: 565 NRCQIQNHCCSLNQTRSPIHC 503 N C HCC N T IHC Sbjct: 25 NECSAFEHCCKGNCTAKRIHC 45 >SB_12488| Best HMM Match : PAN (HMM E-Value=0.0087) Length = 124 Score = 27.9 bits (59), Expect = 9.1 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -2 Query: 652 TSIKFKTHLRISIFPLALKRISTLTFSCLNRCQIQNHCCSLN 527 +SI F + R+ + +A++R ++ SC RC C S N Sbjct: 31 SSIAFTRNKRLLGYTIAIQRTPSV-LSCAQRCLTSRECASFN 71 >SB_7017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1017 Score = 27.9 bits (59), Expect = 9.1 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +1 Query: 238 IRCQKCLEFGHWSYECKGK 294 +RC KC + GH++ C+ K Sbjct: 185 VRCDKCTKVGHFAVVCRSK 203 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,924,820 Number of Sequences: 59808 Number of extensions: 314100 Number of successful extensions: 1381 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1277 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1378 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1998111622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -