BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11f21 (778 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 24 1.6 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 4.8 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 22 6.3 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 21 8.3 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 23.8 bits (49), Expect = 1.6 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +1 Query: 100 EERTKMKLKNVSWSLRKTDKSTPKSQRC 183 + RT + S + R T ++TP S RC Sbjct: 275 QRRTHTRHTTTSHNTRGTPRTTPASSRC 302 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +2 Query: 236 SHPRETTKKSVDKSRRHNINR 298 SHP +K DK+ H NR Sbjct: 988 SHPLAALQKLCDKTETHTNNR 1008 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 21.8 bits (44), Expect = 6.3 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -3 Query: 290 YYVSLIYPHFFS 255 YYV++ +PH F+ Sbjct: 500 YYVNVTFPHLFN 511 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +2 Query: 221 HQTPVSHPRETTKKSVDKSRRHNINRPTRLS 313 HQ PV H + T + + R + PT L+ Sbjct: 195 HQCPVCHKKFTNALVLQQHIRLHTGEPTDLT 225 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,626 Number of Sequences: 336 Number of extensions: 3296 Number of successful extensions: 14 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20961338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -