BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11f19 (683 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12441| Best HMM Match : Ribosomal_L18p (HMM E-Value=0) 169 2e-42 SB_35225| Best HMM Match : Ribosomal_L18p (HMM E-Value=4e-30) 151 5e-37 SB_50387| Best HMM Match : HLH (HMM E-Value=8.2e-05) 29 2.7 SB_33613| Best HMM Match : PAS (HMM E-Value=0.0083) 29 2.7 SB_11523| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_43459| Best HMM Match : VWA (HMM E-Value=1.8e-23) 28 6.1 SB_54131| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_8083| Best HMM Match : Lectin_C (HMM E-Value=3.8e-22) 28 6.1 SB_4647| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_16955| Best HMM Match : SLAP (HMM E-Value=0.048) 28 8.1 >SB_12441| Best HMM Match : Ribosomal_L18p (HMM E-Value=0) Length = 328 Score = 169 bits (410), Expect = 2e-42 Identities = 97/204 (47%), Positives = 119/204 (58%), Gaps = 37/204 (18%) Frame = +2 Query: 119 RRREGKTDYYARKR------------------------LVVQDKNKYNTP------KYRL 208 RR +GKTDYYARKR ++ Q++NK P KYR Sbjct: 17 RRSQGKTDYYARKRLITQDKNKYNTPKYRFVVRITNKDIICQERNKVGGPIFGSTQKYRR 76 Query: 209 IVRLS-NK------DVTCQVAYSRIEGDHIVCAAYSHELPRYGVKVGLTNYAAAYSTGXX 367 R NK ++AY++++GD ++ +AY+HELP +GVKVGLTNYAAAY TG Sbjct: 77 NSRGKYNKRNIFILQTYARIAYAKLDGDRVLASAYAHELPNFGVKVGLTNYAAAYCTGLL 136 Query: 368 XXXXXXXXXXXXXXXXXXXXXXXXEYNVEPVDNGPGAFRCYLDVGLARTTTGARVFGAMK 547 EYNVE VD PGAFRC+LDVGLART+TGARVFGA+K Sbjct: 137 LARRLLTMLNLHEIYTGTDDVNGDEYNVESVDGSPGAFRCFLDVGLARTSTGARVFGALK 196 Query: 548 GAVDGGLNVPHSIKRFPGYDAESK 619 GAVDGGL +PHS+KRFPGYD+ESK Sbjct: 197 GAVDGGLEIPHSMKRFPGYDSESK 220 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = +3 Query: 618 KKFNAEVHRAHIFGLHVAEYM 680 K F+AEVHR HIFG HVAEYM Sbjct: 220 KDFSAEVHRNHIFGKHVAEYM 240 >SB_35225| Best HMM Match : Ribosomal_L18p (HMM E-Value=4e-30) Length = 113 Score = 151 bits (366), Expect = 5e-37 Identities = 69/112 (61%), Positives = 80/112 (71%) Frame = +2 Query: 245 VAYSRIEGDHIVCAAYSHELPRYGVKVGLTNYAAAYSTGXXXXXXXXXXXXXXXXXXXXX 424 +AY+++EGD I+CAAY+HELPRYGVKVGLTNYAAAY TG Sbjct: 1 IAYAKLEGDVIICAAYAHELPRYGVKVGLTNYAAAYCTGLLLARRLLTKLNLHEIYTGTE 60 Query: 425 XXXXXEYNVEPVDNGPGAFRCYLDVGLARTTTGARVFGAMKGAVDGGLNVPH 580 EYNVE +D PGAFRC+LDVGLART+TGARVFGA+KGAVDGGL +PH Sbjct: 61 EVNGDEYNVESIDGSPGAFRCFLDVGLARTSTGARVFGALKGAVDGGLEIPH 112 >SB_50387| Best HMM Match : HLH (HMM E-Value=8.2e-05) Length = 791 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 570 LRPPSTAPFIAPKTRAPVVVRAKPTSK*HLNAPGPLST 457 +RP PF+ P +RAP A PT+ P P S+ Sbjct: 356 MRPAHIGPFLYPDSRAPFSPLASPTASSDSGHPSPGSS 393 >SB_33613| Best HMM Match : PAS (HMM E-Value=0.0083) Length = 624 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 570 LRPPSTAPFIAPKTRAPVVVRAKPTSK*HLNAPGPLST 457 +RP PF+ P +RAP A PT+ P P S+ Sbjct: 222 MRPAHIGPFLYPDSRAPFSPLASPTASSDSGHPSPGSS 259 >SB_11523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/27 (44%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +2 Query: 206 LIVRLSNKDVTCQVAYSRIEGD-HIVC 283 L++ LS +D+TC V YS G+ H +C Sbjct: 108 LLLYLSKRDITCPVPYSSRNGELHTMC 134 >SB_43459| Best HMM Match : VWA (HMM E-Value=1.8e-23) Length = 232 Score = 28.3 bits (60), Expect = 6.1 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -2 Query: 142 ISFPFTTPLEFYLVPLEVLFVLHNFNESHILNLSYK 35 ISFPFTT E Y +V F+ N LNL+ + Sbjct: 119 ISFPFTTRKEAYRQLSKVPFIAGTTNTQEALNLAQR 154 >SB_54131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3160 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +2 Query: 254 SRIEGDHIVCAAYSH-ELPRYGVKVGLTNYAAAY 352 ++ GDH+ A+YSH ++ R+ V + L AAY Sbjct: 133 AKYRGDHLDIASYSHQQIDRFAVLLDLWTNEAAY 166 >SB_8083| Best HMM Match : Lectin_C (HMM E-Value=3.8e-22) Length = 3445 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 615 DSAS*PGNLLME*GTLRPPSTAPFIAPKTRAPV 517 D+ P +M T+RPP T F+ T+APV Sbjct: 1653 DTTVAPETTVMPDTTMRPPKTDVFVTEATKAPV 1685 >SB_4647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2735 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +2 Query: 74 VKNKQYFKRYQVKFKRRREGKTDYYARKRLVV 169 VK+K+ KR K KR+ + K+D + RK+ ++ Sbjct: 228 VKHKRKQKRKSAKHKRKHKRKSDKHKRKQTLI 259 >SB_16955| Best HMM Match : SLAP (HMM E-Value=0.048) Length = 1952 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +2 Query: 59 GFVKVVKNKQYFKRYQVKFKRRREGKTDY 145 GF++ +K + RY VK R R DY Sbjct: 1090 GFIEALKRRDVSSRYNVKHARFRRATNDY 1118 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,616,977 Number of Sequences: 59808 Number of extensions: 465649 Number of successful extensions: 1416 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1263 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1404 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -