BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11f17 (637 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1711.17 |prp16|SPBC17G9.01|ATP-dependent RNA helicase Prp16|... 27 3.0 SPCC1235.10c |sec6||exocyst complex subunit Sec6|Schizosaccharom... 26 5.2 >SPBC1711.17 |prp16|SPBC17G9.01|ATP-dependent RNA helicase Prp16|Schizosaccharomyces pombe|chr 2|||Manual Length = 1173 Score = 26.6 bits (56), Expect = 3.0 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = -3 Query: 251 IIQRYRHGAVWYFAGFVSSFCVRHFVHRALRAVRKNAREQ 132 ++ Y+H W G+ +S+C +HF+H ++ R+Q Sbjct: 971 LLNIYQH---WQRNGYSNSWCSKHFLHSKTLKRARDIRQQ 1007 >SPCC1235.10c |sec6||exocyst complex subunit Sec6|Schizosaccharomyces pombe|chr 3|||Manual Length = 730 Score = 25.8 bits (54), Expect = 5.2 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +3 Query: 282 FDWQDASLNDRERKELSKLFDAVEIMT 362 F+ + ASLN + EL K +AVE++T Sbjct: 34 FEREQASLNMHVKTELEKHVEAVEMLT 60 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,501,164 Number of Sequences: 5004 Number of extensions: 48386 Number of successful extensions: 155 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 150 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 155 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 283719918 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -