BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11f17 (637 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_294| Best HMM Match : Ribosomal_L14 (HMM E-Value=4.1e-23) 29 4.2 SB_55624| Best HMM Match : PHD (HMM E-Value=3.8) 28 7.3 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 >SB_294| Best HMM Match : Ribosomal_L14 (HMM E-Value=4.1e-23) Length = 145 Score = 28.7 bits (61), Expect = 4.2 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 5/89 (5%) Frame = +3 Query: 78 LNVVLNMASNAD-KLLWILLFAGVLSYGTQCPMHEMTD-AKAAYKSG--EIPDSSMP-IT 242 + V+N A N K L+I+ G+ + P D A K G E+ MP + Sbjct: 41 VGAVINCADNTGGKNLYIIAVKGIKGRLNRLPAAASGDMVLATVKKGKPELRKKVMPAVV 100 Query: 243 LDNIKAKLKESGIFDWQDASLNDRERKEL 329 + KA +++G+F + +A++ R RK++ Sbjct: 101 IRQRKAYRRKNGVFLYFEANIKVRVRKQI 129 >SB_55624| Best HMM Match : PHD (HMM E-Value=3.8) Length = 349 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 340 LMQWKL*LHLAIDSLRTCKTCSLLCVSSRESLRSNSKR 453 +M+ K H DSL+TC T L C+ S+ + + KR Sbjct: 252 IMEGKAIQHEIWDSLKTCSTEELRCLLSKPDVVGDLKR 289 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 27.5 bits (58), Expect = 9.7 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = +3 Query: 186 DAKAAYKSGEIPDSSMPITLDNIKAKLKESGIFDWQDASLNDRERKELSKLFDAVEIM 359 + + Y++ + ++ T D IKA LKE F + L RE K L++ V+ M Sbjct: 310 EIRRKYRAHDPSPATKRRTTDRIKALLKEVDEFKVDNTKLKPREAKALAQARFTVKYM 367 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,834,798 Number of Sequences: 59808 Number of extensions: 363685 Number of successful extensions: 987 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 955 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 987 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1596754500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -