BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11f17 (637 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 24 1.1 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 24 1.1 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 2.5 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 24.2 bits (50), Expect = 1.1 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = +3 Query: 24 IRTYSQSFCYRFERFTFELNV 86 +R ++ C +ERFT+++N+ Sbjct: 487 LRLKARRACMNYERFTYKINI 507 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 24.2 bits (50), Expect = 1.1 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = +3 Query: 24 IRTYSQSFCYRFERFTFELNV 86 +R ++ C +ERFT+++N+ Sbjct: 487 LRLKARRACMNYERFTYKINI 507 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 23.0 bits (47), Expect = 2.5 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = -1 Query: 187 SVISCIGHCVP*ERTPANSKIHNSLSAFEAMFN---TTLSSNVNLSK 56 SVIS G VP PA+S NS++ + + N T +++N K Sbjct: 845 SVISMSGTTVPITSLPASSTSINSITVEKDVINDVKTQITTNTPAKK 891 Score = 21.8 bits (44), Expect = 5.7 Identities = 16/72 (22%), Positives = 32/72 (44%), Gaps = 2/72 (2%) Frame = +3 Query: 312 RERKELSKLFDA--VEIMTTSRNRQPPNVQNMFSTLRLVERVVKKQLKEGQISESLAGKF 485 +++K+ L A + I N + ++ +FSTL+ E + L + +E + + Sbjct: 91 KQKKKKRSLMGAQGLSIRGLQINHEDETIRPVFSTLQRAEYPTNRSLFIREQTEEMYREM 150 Query: 486 QWEKLSTRQRRE 521 E R RR+ Sbjct: 151 LLEHKKRRARRD 162 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,650 Number of Sequences: 438 Number of extensions: 3213 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19071468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -