BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11f15 (758 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 24 5.9 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 23 7.7 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = -2 Query: 112 IFSRVAVIRVHF*GCW*NFIVYFVFWLWYFEL 17 + + ++ + F CW F +YF+ +Y EL Sbjct: 295 VVKMMMIVVIIFAVCWLPFQIYFILTSYYPEL 326 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 23.4 bits (48), Expect = 7.7 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = -1 Query: 560 FHDSIDFSIVPSHLVDELPI 501 +HD + ++P HL+ +PI Sbjct: 536 YHDFKEADVLPQHLLSRVPI 555 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 738,291 Number of Sequences: 2352 Number of extensions: 14904 Number of successful extensions: 34 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -