BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11f15 (758 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78542-6|CAB01749.2| 695|Caenorhabditis elegans Hypothetical pr... 31 0.67 Z81110-3|CAB03257.1| 323|Caenorhabditis elegans Hypothetical pr... 29 3.6 AL032639-3|CAA21635.1| 283|Caenorhabditis elegans Hypothetical ... 28 8.3 >Z78542-6|CAB01749.2| 695|Caenorhabditis elegans Hypothetical protein F20D1.7 protein. Length = 695 Score = 31.5 bits (68), Expect = 0.67 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +3 Query: 132 IKGANDKCSLKASLDIQNRGPNRIVELNEAKCKQKV-IVHRCNIFTRTAENIYD 290 IKG CS S D+Q+ G IV+ N+A CK K+ V + + +T E D Sbjct: 346 IKGTQLDCSC-TSRDMQDYGAITIVDWNDATCKTKIGAVQKLSHLEKTGEPCRD 398 >Z81110-3|CAB03257.1| 323|Caenorhabditis elegans Hypothetical protein T01D3.4 protein. Length = 323 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/48 (35%), Positives = 29/48 (60%) Frame = +3 Query: 345 NNHLVNVSKDVLILLCFLIANFIVLMIIIFNISCDVYFGIKQAATRRS 488 N++ NV+ D+L L+C ++A F V++ I+ I + F KQ+ T S Sbjct: 168 NDNCDNVNLDILKLICLVLAVFNVVVQILNLIKIKLMFS-KQSRTASS 214 >AL032639-3|CAA21635.1| 283|Caenorhabditis elegans Hypothetical protein Y38F1A.2 protein. Length = 283 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +3 Query: 270 TAENIYDKCASYNLRYCPFGRFVKSNNHLVNVSKDVLILLCFLIANF 410 T+E D N+R + R N +++ +D+ IL+ +LI NF Sbjct: 165 TSEETDDHIQENNIRIDDYNRRFSINRPVLDYIRDIPILIPYLIRNF 211 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,202,945 Number of Sequences: 27780 Number of extensions: 337395 Number of successful extensions: 875 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 844 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 875 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1809061256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -