BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11f15 (758 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 25 0.77 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 24 1.3 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 24 1.3 DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 23 2.4 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 23 3.1 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 23 4.1 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 22 5.4 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 22 5.4 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 22 5.4 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 22 5.4 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 22 5.4 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 22 5.4 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 22 5.4 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 5.4 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 5.4 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 5.4 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 5.4 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 5.4 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 5.4 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 5.4 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 5.4 AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 22 7.2 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 25.0 bits (52), Expect = 0.77 Identities = 10/41 (24%), Positives = 21/41 (51%) Frame = +3 Query: 555 VKNIVRRYITNSVSIYVLDGSRKNRFWKSLINK*AKSKHFV 677 +K I R++ + ++Y+L +F++ I S+H V Sbjct: 221 LKGIARQFYNDDANVYILPDPYNTKFFRYRITPELYSEHLV 261 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 633 WKSLINK*AKSKHFVAGVHR 692 W S IN K FV G HR Sbjct: 391 WSSFINPWTKKLEFVVGQHR 410 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 633 WKSLINK*AKSKHFVAGVHR 692 W S IN K FV G HR Sbjct: 97 WSSFINPWTKKLEFVVGQHR 116 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 23.4 bits (48), Expect = 2.4 Identities = 16/69 (23%), Positives = 29/69 (42%), Gaps = 2/69 (2%) Frame = -3 Query: 309 NYTKRIYHKYFLLFA*KCYSDERLLSVCTSLRSALRFDSARGFVCP--KTLSNYICHSPP 136 ++TK++ H L +SD+++ SV S A+R + P K + P Sbjct: 298 DHTKQLSHDVLLRAKQIGFSDKQIASVVKSSELAVRIQRQENNIRPMVKQIDTVAAEWPA 357 Query: 135 *FRYIYKAF 109 Y+Y + Sbjct: 358 TTNYLYLTY 366 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 23.0 bits (47), Expect = 3.1 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 196 FGPRFCMSKDAFKLHLSFAPLI 131 FGPRFC + AF + S A ++ Sbjct: 93 FGPRFCDTWIAFDVMCSTASIL 114 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 22.6 bits (46), Expect = 4.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +3 Query: 285 YDKCASYNLRYCPFGRFVKSNNHLVNV 365 Y +S+NL Y +FVKS NV Sbjct: 265 YSALSSHNLNYVNTEQFVKSQYQANNV 291 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.4 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = -1 Query: 551 SIDFSIVPSHLVDELPI 501 S + I+PSH ++++P+ Sbjct: 76 SREHRIIPSHYIEQIPV 92 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.4 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = -1 Query: 551 SIDFSIVPSHLVDELPI 501 S + I+PSH ++++P+ Sbjct: 76 SREHRIIPSHYIEQIPV 92 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.4 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = -1 Query: 551 SIDFSIVPSHLVDELPI 501 S + I+PSH ++++P+ Sbjct: 76 SREHRIIPSHYIEQIPV 92 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.4 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = -1 Query: 551 SIDFSIVPSHLVDELPI 501 S + I+PSH ++++P+ Sbjct: 76 SREHRIIPSHYIEQIPV 92 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.4 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = -1 Query: 551 SIDFSIVPSHLVDELPI 501 S + I+PSH ++++P+ Sbjct: 76 SREHRIIPSHYIEQIPV 92 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.4 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = -1 Query: 551 SIDFSIVPSHLVDELPI 501 S + I+PSH ++++P+ Sbjct: 76 SREHRIIPSHYIEQIPV 92 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.4 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = -1 Query: 551 SIDFSIVPSHLVDELPI 501 S + I+PSH ++++P+ Sbjct: 76 SREHRIIPSHYIEQIPV 92 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.4 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = -1 Query: 551 SIDFSIVPSHLVDELPI 501 S + I+PSH ++++P+ Sbjct: 325 SREHRIIPSHYIEQIPV 341 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.4 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = -1 Query: 551 SIDFSIVPSHLVDELPI 501 S + I+PSH ++++P+ Sbjct: 325 SREHRIIPSHYIEQIPV 341 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.4 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = -1 Query: 551 SIDFSIVPSHLVDELPI 501 S + I+PSH ++++P+ Sbjct: 325 SREHRIIPSHYIEQIPV 341 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.4 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = -1 Query: 551 SIDFSIVPSHLVDELPI 501 S + I+PSH ++++P+ Sbjct: 325 SREHRIIPSHYIEQIPV 341 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.4 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = -1 Query: 551 SIDFSIVPSHLVDELPI 501 S + I+PSH ++++P+ Sbjct: 325 SREHRIIPSHYIEQIPV 341 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.4 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = -1 Query: 551 SIDFSIVPSHLVDELPI 501 S + I+PSH ++++P+ Sbjct: 325 SREHRIIPSHYIEQIPV 341 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.2 bits (45), Expect = 5.4 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = -1 Query: 551 SIDFSIVPSHLVDELPI 501 S + I+PSH ++++P+ Sbjct: 309 SREHRIIPSHYIEQIPV 325 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 5.4 Identities = 6/17 (35%), Positives = 13/17 (76%) Frame = -1 Query: 551 SIDFSIVPSHLVDELPI 501 S + I+PSH ++++P+ Sbjct: 325 SREHRIIPSHYIEQIPV 341 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 21.8 bits (44), Expect = 7.2 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = +3 Query: 354 LVNVSKDVLILLCFLIANFIVLMIIIFNISCDVYFGIKQAATRRSAV-ITYRKFI 515 ++ VSK + L F IVL IIF IS +FG A + IT+ F+ Sbjct: 37 ILGVSKQIETGLAFPSITLIVLGSIIFVIS---FFGCCGAIRESHCMTITFASFL 88 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,751 Number of Sequences: 438 Number of extensions: 4538 Number of successful extensions: 32 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23875740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -