BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11f10 (692 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9U3U9 Cluster: Unconventional myosin PfM-B; n=6; Plasm... 34 2.9 UniRef50_Q4DJM1 Cluster: Putative uncharacterized protein; n=2; ... 33 5.0 UniRef50_A2EZ89 Cluster: Putative uncharacterized protein; n=1; ... 33 6.6 UniRef50_A6USX7 Cluster: Glucose-6-phosphate isomerase; n=1; Met... 33 8.8 >UniRef50_Q9U3U9 Cluster: Unconventional myosin PfM-B; n=6; Plasmodium|Rep: Unconventional myosin PfM-B - Plasmodium falciparum Length = 801 Score = 34.3 bits (75), Expect = 2.9 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -1 Query: 236 LTSTHARNNVVNYMYLEKAESQCYYLKMSTYYIHSFINHNE 114 +T + R N++ Y YLE + C YLK + Y I NE Sbjct: 613 VTDSLGRKNLITYKYLENLKQICSYLKSTNIYFIKCIKPNE 653 >UniRef50_Q4DJM1 Cluster: Putative uncharacterized protein; n=2; Trypanosoma cruzi|Rep: Putative uncharacterized protein - Trypanosoma cruzi Length = 701 Score = 33.5 bits (73), Expect = 5.0 Identities = 16/57 (28%), Positives = 31/57 (54%) Frame = +2 Query: 101 CKINFRYDL*SCECNKSTFSSNNIVIQPFLNTYNLQHYSLHVSMLILSVIGLAHAVI 271 C+ N L C + ++N V+Q L+ +N+Q Y+L+ ++ S++ L +A I Sbjct: 236 CEANKLIGLAGRVCMEGNLNANTFVVQ--LSEWNIQRYTLYFIAMLFSIVTLVYATI 290 >UniRef50_A2EZ89 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 567 Score = 33.1 bits (72), Expect = 6.6 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +1 Query: 178 SAFSKYI*FTTLFLACVDVNIKRHRARSCSNF 273 +A+SK+ L ACVD+N+ R+ A C NF Sbjct: 255 AAYSKFPDDINLACACVDINLARNEANKCLNF 286 >UniRef50_A6USX7 Cluster: Glucose-6-phosphate isomerase; n=1; Methanococcus aeolicus Nankai-3|Rep: Glucose-6-phosphate isomerase - Methanococcus aeolicus Nankai-3 Length = 434 Score = 32.7 bits (71), Expect = 8.8 Identities = 19/63 (30%), Positives = 28/63 (44%) Frame = +2 Query: 104 KINFRYDL*SCECNKSTFSSNNIVIQPFLNTYNLQHYSLHVSMLILSVIGLAHAVISTQT 283 KIN YD +C I+ L Y L+ YS ++ VIG+ +++ TQ Sbjct: 31 KINTAYDKVMQKCKNDELGFMKIIYDDILIYYELKEYSKDFDNIV--VIGMGGSILGTQA 88 Query: 284 ILE 292 I E Sbjct: 89 IYE 91 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 552,767,643 Number of Sequences: 1657284 Number of extensions: 8934852 Number of successful extensions: 19847 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 18737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19821 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 54545459628 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -