BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11f04 (690 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 88 2e-19 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 24 3.9 AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CY... 23 9.1 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 23 9.1 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 88.2 bits (209), Expect = 2e-19 Identities = 48/107 (44%), Positives = 66/107 (61%), Gaps = 2/107 (1%) Frame = +3 Query: 87 SNIKIGKDKFQLSVDVHKFNKDELRVKARPDCLVIEGKQERKTKT-GYVMRRFTRKFRLP 263 S + I KDKFQ+++DV +F+ +E+ VK +C+++EGK E K GYV R F R++ LP Sbjct: 6 SAVNISKDKFQINLDVQQFSPEEISVKYVDNCVLVEGKHEEKQDDHGYVSRHFVRRYMLP 65 Query: 264 PGCSPKKIESKLSPEGILTITAPRKNWETTTPCETLIPIGYS-DPQK 401 G + I S LS +GILTIT PRK E E IPI ++ P K Sbjct: 66 KGHNEADIVSSLSSDGILTITCPRKEIEQKNE-ERSIPITHTGQPMK 111 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 24.2 bits (50), Expect = 3.9 Identities = 12/50 (24%), Positives = 27/50 (54%) Frame = +3 Query: 69 QTRNLRSNIKIGKDKFQLSVDVHKFNKDELRVKARPDCLVIEGKQERKTK 218 + R+LR ++ +++F+ + +E+R KA + L+ + + KTK Sbjct: 836 EERSLRQKQELEREEFKRRQAEDRRRMEEMRRKAHEEMLLKRQEYKEKTK 885 >AY062206-1|AAL58567.1| 193|Anopheles gambiae cytochrome P450 CYP4H24 protein. Length = 193 Score = 23.0 bits (47), Expect = 9.1 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -1 Query: 135 EHRHSAGTYLFLF*YSTLDFVFEELLRL 52 E+RH TY L + LD V +E LRL Sbjct: 36 EYRHVPLTYNTLQNFPYLDMVVKESLRL 63 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 Query: 353 SCFPIFSRRCYRENAFRRQLRF 288 S FP + +C+ E F LRF Sbjct: 213 SGFPAWKTQCFNEELFIEALRF 234 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 579,021 Number of Sequences: 2352 Number of extensions: 10866 Number of successful extensions: 16 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69831885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -