BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11f01 (727 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59710| Best HMM Match : Peptidase_S24 (HMM E-Value=0.7) 84 1e-16 SB_1737| Best HMM Match : UPF0147 (HMM E-Value=6) 62 6e-10 >SB_59710| Best HMM Match : Peptidase_S24 (HMM E-Value=0.7) Length = 230 Score = 83.8 bits (198), Expect = 1e-16 Identities = 40/107 (37%), Positives = 62/107 (57%), Gaps = 2/107 (1%) Frame = +1 Query: 361 PSMEPTLESNNIL-LTEHISPRLQKLRRGDIIIAKSPSNPRQNICKRIKGLPGDKVRG-N 534 PS ++ +I+ L + + ++RGD++ P +P + KRI L GD V+ Sbjct: 54 PSFNTDYKTRDIVVLNKWCVKNFKGIKRGDVVSIVDPHDPDIMLIKRIVALQGDHVKAIG 113 Query: 535 FPKRSQVVPRGHVWLEGDNSSNSADSRIYGPVPAGLIRSRVVCRVWP 675 + R +PRGH W+EGDNS++S DS +GPVP GLI+++ VWP Sbjct: 114 YKNRYVKIPRGHCWIEGDNSNHSMDSNTFGPVPVGLIQAKATHVVWP 160 >SB_1737| Best HMM Match : UPF0147 (HMM E-Value=6) Length = 253 Score = 61.7 bits (143), Expect = 6e-10 Identities = 23/40 (57%), Positives = 31/40 (77%) Frame = +1 Query: 556 VPRGHVWLEGDNSSNSADSRIYGPVPAGLIRSRVVCRVWP 675 +PRGH W+EGDNS++S DS +GPVP GLI+++ VWP Sbjct: 144 IPRGHCWIEGDNSNHSMDSNTFGPVPVGLIQAKATHVVWP 183 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,915,461 Number of Sequences: 59808 Number of extensions: 437227 Number of successful extensions: 831 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 766 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 830 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -