BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11e24 (725 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 24 1.7 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 23 2.9 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 2.9 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 2.9 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 3.9 L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. 22 6.8 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 6.8 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 6.8 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 9.0 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 9.0 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 9.0 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 9.0 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 9.0 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 9.0 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 9.0 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 9.0 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 9.0 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 9.0 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 9.0 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 9.0 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 9.0 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 9.0 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 9.0 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 9.0 AF134818-1|AAD40234.1| 130|Apis mellifera lambda crystallin-lik... 21 9.0 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.8 bits (49), Expect = 1.7 Identities = 22/80 (27%), Positives = 34/80 (42%), Gaps = 1/80 (1%) Frame = -1 Query: 257 KMSVSPLGHSSMIIIPYSSANWYISSAYG*CDVRNAF-APIHLIKLKFFTHKTGSHPLPL 81 K+ G IIP + + WY++ Y + N F I L FF + + P L Sbjct: 187 KLDTKTSGKYKEYIIPANYSGWYLNHDYNLENKLNYFIEDIGLNTYYFFLRQ--AFPFWL 244 Query: 80 RSESSCIPNPLRYNGFEFKY 21 S+ +P+ Y G E+ Y Sbjct: 245 PSKEYDLPD---YRGEEYLY 261 Score = 23.0 bits (47), Expect = 2.9 Identities = 11/39 (28%), Positives = 19/39 (48%), Gaps = 5/39 (12%) Frame = +1 Query: 466 NTDRAGQHLDVICFNRYNGWYQN-----TGDLNYIVSKV 567 +T +G++ + I Y+GWY N LNY + + Sbjct: 189 DTKTSGKYKEYIIPANYSGWYLNHDYNLENKLNYFIEDI 227 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -3 Query: 456 RDRDGDGSGEVHGLHVFHYFSEIGIGLLFG 367 RDR G G H + HY +I + +G Sbjct: 316 RDRRGRGRSREHRIIPSHYIEQIPAPVYYG 345 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 Query: 130 IKWIGANAFRTSHYPYA 180 +KW G + TS +PYA Sbjct: 228 VKWTGKVVYFTSLFPYA 244 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 Query: 130 IKWIGANAFRTSHYPYA 180 +KW G + TS +PYA Sbjct: 281 VKWTGKVVYFTSLFPYA 297 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 22.6 bits (46), Expect = 3.9 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +1 Query: 466 NTDRAGQHLDVICFNRYNGWYQN 534 +T +G++ + I Y+GWY N Sbjct: 189 DTKTSGKYKEYIIPANYSGWYLN 211 >L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. Length = 149 Score = 21.8 bits (44), Expect = 6.8 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = -3 Query: 183 LSVRIMRCP---ERVRSDPFDQVKILHPQNWVPSFASEIRVFVHPKSP 49 L+ RI C +R +DPF + I + WV + R + P+ P Sbjct: 5 LTQRINSCDLLKKRNENDPFLKRPITGDEKWVVNNIKRKRWWSRPREP 52 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.8 bits (44), Expect = 6.8 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = +1 Query: 259 TQSLLNKHKQSLTELI 306 T+SLLN+H + + +L+ Sbjct: 640 TESLLNRHNEDMEKLM 655 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.8 bits (44), Expect = 6.8 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -2 Query: 253 CLCLRWDTHQ*SLSHIRRPTGIFPQRTD 170 C +++ T++ +IR IFPQRTD Sbjct: 154 CNHIKYSTNK---GNIRSAITIFPQRTD 178 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -3 Query: 456 RDRDGDGSGEVHGLHVFHYFSEIGIGLLFG 367 RDR G H + HY +I + + +G Sbjct: 68 RDRRERGRSREHRIIPSHYIEQIPVPVYYG 97 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -3 Query: 456 RDRDGDGSGEVHGLHVFHYFSEIGIGLLFG 367 RDR G H + HY +I + + +G Sbjct: 68 RDRRERGRSREHRIIPSHYIEQIPVPVYYG 97 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -3 Query: 456 RDRDGDGSGEVHGLHVFHYFSEIGIGLLFG 367 RDR G H + HY +I + + +G Sbjct: 68 RDRRERGRSREHRIIPSHYIEQIPVPVYYG 97 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -3 Query: 456 RDRDGDGSGEVHGLHVFHYFSEIGIGLLFG 367 RDR G H + HY +I + + +G Sbjct: 68 RDRRERGRSREHRIIPSHYIEQIPVPVYYG 97 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -3 Query: 456 RDRDGDGSGEVHGLHVFHYFSEIGIGLLFG 367 RDR G H + HY +I + + +G Sbjct: 68 RDRRERGRSREHRIIPSHYIEQIPVPVYYG 97 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -3 Query: 456 RDRDGDGSGEVHGLHVFHYFSEIGIGLLFG 367 RDR G H + HY +I + + +G Sbjct: 68 RDRRERGRSREHRIIPSHYIEQIPVPVYYG 97 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -3 Query: 456 RDRDGDGSGEVHGLHVFHYFSEIGIGLLFG 367 RDR G H + HY +I + + +G Sbjct: 68 RDRRERGRSREHRIIPSHYIEQIPVPVYYG 97 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -3 Query: 456 RDRDGDGSGEVHGLHVFHYFSEIGIGLLFG 367 RDR G H + HY +I + + +G Sbjct: 317 RDRRERGRSREHRIIPSHYIEQIPVPVYYG 346 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -3 Query: 456 RDRDGDGSGEVHGLHVFHYFSEIGIGLLFG 367 RDR G H + HY +I + + +G Sbjct: 317 RDRRERGRSREHRIIPSHYIEQIPVPVYYG 346 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -3 Query: 456 RDRDGDGSGEVHGLHVFHYFSEIGIGLLFG 367 RDR G H + HY +I + + +G Sbjct: 317 RDRRERGRSREHRIIPSHYIEQIPVPVYYG 346 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -3 Query: 456 RDRDGDGSGEVHGLHVFHYFSEIGIGLLFG 367 RDR G H + HY +I + + +G Sbjct: 317 RDRRERGRSREHRIIPSHYIEQIPVPVYYG 346 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -3 Query: 456 RDRDGDGSGEVHGLHVFHYFSEIGIGLLFG 367 RDR G H + HY +I + + +G Sbjct: 317 RDRRERGRSREHRIIPSHYIEQIPVPVYYG 346 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -3 Query: 456 RDRDGDGSGEVHGLHVFHYFSEIGIGLLFG 367 RDR G H + HY +I + + +G Sbjct: 317 RDRRERGRSREHRIIPSHYIEQIPVPVYYG 346 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -3 Query: 456 RDRDGDGSGEVHGLHVFHYFSEIGIGLLFG 367 RDR G H + HY +I + + +G Sbjct: 301 RDRRERGRSREHRIIPSHYIEQIPVPVYYG 330 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -3 Query: 456 RDRDGDGSGEVHGLHVFHYFSEIGIGLLFG 367 RDR G H + HY +I + + +G Sbjct: 317 RDRRERGRSREHRIIPSHYIEQIPVPVYYG 346 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 623 NMALTLLPAYTLFQNMCGLKNTK 691 N+ ++ P +N C LKNT+ Sbjct: 469 NLEISTRPKSNTVENACVLKNTE 491 >AF134818-1|AAD40234.1| 130|Apis mellifera lambda crystallin-like protein protein. Length = 130 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/29 (27%), Positives = 18/29 (62%) Frame = -2 Query: 478 LYQCCNIARSRW*RVWRGPWTSRVSLLQR 392 L + C + + + R+WR +++SLL++ Sbjct: 99 LNEMCPLEKLKERRIWRDDALTKLSLLKK 127 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,704 Number of Sequences: 438 Number of extensions: 4587 Number of successful extensions: 29 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -