BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11e22 (632 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30321| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_13178| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 >SB_30321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 599 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -1 Query: 530 STRTTGKTGIGRWVRMTLLIICSSLLGVRILRSIISLN 417 +TR KT RWV L +IC+ L+ V +L + LN Sbjct: 30 ATRWRRKTMCARWVIAVLTLICTGLIVVLLLTFELQLN 67 >SB_13178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 29.5 bits (63), Expect = 2.4 Identities = 17/73 (23%), Positives = 28/73 (38%), Gaps = 1/73 (1%) Frame = +3 Query: 207 PAPTSFSYPQSAAHKPSLSGWQEKPATNTXXXXXXXXXXXXXXXXXXYPSSQTGLSGNSQ 386 P P+ YP Q++P + P S+ G++G S+ Sbjct: 117 PPPSMAPYPPGPNQGTPPPSTQQQPGSGGYPMMYPQQPGYYPAGTAPPPYSEAGVAGTSE 176 Query: 387 P-KQPPKYQETVQ 422 P PPKY++ V+ Sbjct: 177 PLPPPPKYEDVVK 189 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,958,981 Number of Sequences: 59808 Number of extensions: 305716 Number of successful extensions: 771 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 771 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1584657875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -