BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11e20 (498 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT010092-1|AAQ22561.1| 470|Drosophila melanogaster LD01958p pro... 28 8.1 AE014298-1851|AAF48230.1| 559|Drosophila melanogaster CG4330-PA... 28 8.1 >BT010092-1|AAQ22561.1| 470|Drosophila melanogaster LD01958p protein. Length = 470 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +1 Query: 331 ILDIVLWSLLYQKTGYNFSIYNRL*LIPMYLSTI 432 + + LW++L + G ++ Y +L +P Y+S I Sbjct: 345 LTSVPLWAILLTQCGQGWAFYTQLTELPTYMSNI 378 >AE014298-1851|AAF48230.1| 559|Drosophila melanogaster CG4330-PA protein. Length = 559 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +1 Query: 331 ILDIVLWSLLYQKTGYNFSIYNRL*LIPMYLSTI 432 + + LW++L + G ++ Y +L +P Y+S I Sbjct: 345 LTSVPLWAILLTQCGQGWAFYTQLTELPTYMSNI 378 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,522,177 Number of Sequences: 53049 Number of extensions: 379849 Number of successful extensions: 865 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 814 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 865 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1763278080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -