BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11e20 (498 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY130758-3|AAN61519.1| 10578|Caenorhabditis elegans 1MDa_1 prote... 31 0.61 AY130758-2|AAN61518.1| 18519|Caenorhabditis elegans 2MDa_2 prote... 31 0.61 AY130758-1|AAN61517.1| 18534|Caenorhabditis elegans 2MDa_1 prote... 31 0.61 U80024-8|AAK18887.3| 288|Caenorhabditis elegans Serpentine rece... 27 10.0 >AY130758-3|AAN61519.1| 10578|Caenorhabditis elegans 1MDa_1 protein protein. Length = 10578 Score = 30.7 bits (66), Expect = 0.61 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 133 DLVFGGHFLQTEPFILLNFYDYDNVNLVLF 44 D+ G + T+ + LNFYDYD + L +F Sbjct: 8632 DIEAGEESIHTDALVDLNFYDYDQMELSIF 8661 >AY130758-2|AAN61518.1| 18519|Caenorhabditis elegans 2MDa_2 protein protein. Length = 18519 Score = 30.7 bits (66), Expect = 0.61 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 133 DLVFGGHFLQTEPFILLNFYDYDNVNLVLF 44 D+ G + T+ + LNFYDYD + L +F Sbjct: 8652 DIEAGEESIHTDALVDLNFYDYDQMELSIF 8681 >AY130758-1|AAN61517.1| 18534|Caenorhabditis elegans 2MDa_1 protein protein. Length = 18534 Score = 30.7 bits (66), Expect = 0.61 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 133 DLVFGGHFLQTEPFILLNFYDYDNVNLVLF 44 D+ G + T+ + LNFYDYD + L +F Sbjct: 8652 DIEAGEESIHTDALVDLNFYDYDQMELSIF 8681 >U80024-8|AAK18887.3| 288|Caenorhabditis elegans Serpentine receptor, class bc (class b-like) protein 9 protein. Length = 288 Score = 26.6 bits (56), Expect = 10.0 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 344 FSGAFCTKKQVIISVYTIVFNLY 412 FS F T VI SV+TI N+Y Sbjct: 12 FSAVFVTSIGVICSVFTIFMNIY 34 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,524,428 Number of Sequences: 27780 Number of extensions: 211905 Number of successful extensions: 613 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 600 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 613 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 945973702 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -