BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11e16 (737 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC105.01c |||potassium ion/proton antiporter|Schizosaccharomyc... 29 0.52 SPAC4A8.08c |vas1||mitochondrial valine-tRNA ligase Vas1|Schizos... 29 0.69 SPCC584.05 |sec1||SNARE binding protein Sec1|Schizosaccharomyces... 27 2.8 SPAC19B12.05c |fcp1||CTD phosphatase Fcp1 |Schizosaccharomyces p... 26 6.4 >SPAC105.01c |||potassium ion/proton antiporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 898 Score = 29.5 bits (63), Expect = 0.52 Identities = 14/52 (26%), Positives = 27/52 (51%) Frame = +2 Query: 191 QLNVRNDGNVQSPHGRLSSLVRV*FITASYQTAPALVLMYNCEELDTMMEKL 346 ++NV GN+ S L L++ +T S++T ++ + C + + EKL Sbjct: 794 RINVVKFGNLNSLLSCLHELIQPATLTPSFETEKSITMFLGCRDKQAVSEKL 845 >SPAC4A8.08c |vas1||mitochondrial valine-tRNA ligase Vas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 950 Score = 29.1 bits (62), Expect = 0.69 Identities = 10/35 (28%), Positives = 23/35 (65%) Frame = +2 Query: 269 TASYQTAPALVLMYNCEELDTMMEKLANLRPALIN 373 ++ Y+ AP+ + + NCE ++ K+ +++ AL+N Sbjct: 913 SSGYEKAPSYIKLKNCELQKDILVKIQDIKQALLN 947 >SPCC584.05 |sec1||SNARE binding protein Sec1|Schizosaccharomyces pombe|chr 3|||Manual Length = 693 Score = 27.1 bits (57), Expect = 2.8 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = -3 Query: 627 IFYLFHVYRRQQTLQRHFALFRGFSVLFSSKEVVQTLEKL 508 + L+ +YR LQ F LFR ++ S +++ Q LE+L Sbjct: 409 LLLLYIIYRDGIILQDLFRLFRHSNLSTSREQIFQNLEQL 448 >SPAC19B12.05c |fcp1||CTD phosphatase Fcp1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 723 Score = 25.8 bits (54), Expect = 6.4 Identities = 12/36 (33%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = +3 Query: 516 PKFGRLLYWK-KELKSHETMQNVFEEFAASCTHEIN 620 P G L+ W K+ +S E + + CTHE+N Sbjct: 69 PVEGELVEWAVKKEESIENFSKIVAKLHEPCTHEVN 104 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,652,018 Number of Sequences: 5004 Number of extensions: 51126 Number of successful extensions: 111 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 111 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 349251756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -