BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11e15 (741 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value M29494-1|AAA27729.1| 74|Apis mellifera protein ( Bee homeobox-... 24 1.7 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 23 4.0 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 23 4.0 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 23 4.0 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 4.0 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 4.0 M29493-1|AAA27728.1| 74|Apis mellifera protein ( Bee homeobox-... 22 5.3 M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-... 22 5.3 EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholi... 22 5.3 EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholi... 22 5.3 EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholi... 22 5.3 EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholi... 22 5.3 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 5.3 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 22 7.0 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 9.2 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 21 9.2 >M29494-1|AAA27729.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H15. ). Length = 74 Score = 23.8 bits (49), Expect = 1.7 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 385 HALCAASCVVELWRRVRRWKL 323 HALC +++W + RR KL Sbjct: 43 HALCLTERQIKIWFQNRRMKL 63 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 474 LVPEGHSCVHVPPGQTKS 421 +V SC++VPPG KS Sbjct: 92 VVTHNGSCLYVPPGIFKS 109 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 474 LVPEGHSCVHVPPGQTKS 421 +V SC++VPPG KS Sbjct: 160 VVTHNGSCLYVPPGIFKS 177 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 474 LVPEGHSCVHVPPGQTKS 421 +V SC++VPPG KS Sbjct: 160 VVTHNGSCLYVPPGIFKS 177 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 646 AAPAYEPRRRHATTGVPQ 699 + P E RR+H GVP+ Sbjct: 1065 SGPMSEERRQHTAEGVPE 1082 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.6 bits (46), Expect = 4.0 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = -3 Query: 247 IMGLHKIRTPFTSPVSHKCYLTSHVLIPHC*DYRIT 140 I L K+++P ++ K +H+L H DY ++ Sbjct: 740 IQSLMKLKSPEWKDLAKKARSVNHLLTHHEYDYELS 775 >M29493-1|AAA27728.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H90. ). Length = 74 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -3 Query: 385 HALCAASCVVELWRRVRRWK 326 HALC +++W + RR K Sbjct: 43 HALCLTERQIKIWFQNRRMK 62 >M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H55. ). Length = 86 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -3 Query: 385 HALCAASCVVELWRRVRRWK 326 HALC +++W + RR K Sbjct: 43 HALCLTERQIKIWFQNRRMK 62 >EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 6 protein. Length = 461 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 474 LVPEGHSCVHVPPGQTKS 421 +V SC++VPPG KS Sbjct: 92 VVTHDGSCLYVPPGIFKS 109 >EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 5 protein. Length = 461 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 474 LVPEGHSCVHVPPGQTKS 421 +V SC++VPPG KS Sbjct: 92 VVTHDGSCLYVPPGIFKS 109 >EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 4 protein. Length = 461 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 474 LVPEGHSCVHVPPGQTKS 421 +V SC++VPPG KS Sbjct: 92 VVTHDGSCLYVPPGIFKS 109 >EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 2 protein. Length = 461 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 474 LVPEGHSCVHVPPGQTKS 421 +V SC++VPPG KS Sbjct: 92 VVTHDGSCLYVPPGIFKS 109 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -3 Query: 385 HALCAASCVVELWRRVRRWK 326 HALC +++W + RR K Sbjct: 305 HALCLTERQIKIWFQNRRMK 324 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 21.8 bits (44), Expect = 7.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 168 IKTCDVK*HLCDTGEVNGVRILCKP 242 I CD + + D+G +N VR +C P Sbjct: 127 IDMCD-RLWVLDSGLINNVRSVCPP 150 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.4 bits (43), Expect = 9.2 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 474 LVPEGHSCVHVPPGQTKS 421 +V +C++VPPG KS Sbjct: 129 VVKNNGTCLYVPPGIFKS 146 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.4 bits (43), Expect = 9.2 Identities = 5/14 (35%), Positives = 11/14 (78%) Frame = +3 Query: 201 DTGEVNGVRILCKP 242 D+G +N ++++C P Sbjct: 143 DSGLINNIQLMCSP 156 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,766 Number of Sequences: 438 Number of extensions: 3486 Number of successful extensions: 19 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -