BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11e14 (550 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016675-7|AAB66135.1| 387|Caenorhabditis elegans Hypothetical ... 28 5.1 U23172-15|AAN63408.1| 374|Caenorhabditis elegans Hypothetical p... 27 8.9 U23172-14|AAL02495.1| 165|Caenorhabditis elegans Hypothetical p... 27 8.9 U23172-12|ABH03526.1| 562|Caenorhabditis elegans Hypothetical p... 27 8.9 >AF016675-7|AAB66135.1| 387|Caenorhabditis elegans Hypothetical protein T27B7.3 protein. Length = 387 Score = 27.9 bits (59), Expect = 5.1 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 96 WHFLSEYHTSSSW*PKRKVAELKLRQLNPSPLKMSLKKQKFQ 221 WH L ++H S+ RK ++ K RQL + L ++K + Sbjct: 206 WHILMKFHKCSATVAYRKSSDEKTRQLQKVIRNVCLDREKMK 247 >U23172-15|AAN63408.1| 374|Caenorhabditis elegans Hypothetical protein F25B5.7d protein. Length = 374 Score = 27.1 bits (57), Expect = 8.9 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +2 Query: 395 KLLVENLPSSYLFDYQEKLKELFSKHGEI 481 +L V NLP+ + +LKELFS HG+I Sbjct: 117 RLFVGNLPNEVK---ETELKELFSPHGDI 142 >U23172-14|AAL02495.1| 165|Caenorhabditis elegans Hypothetical protein F25B5.7b protein. Length = 165 Score = 27.1 bits (57), Expect = 8.9 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +2 Query: 395 KLLVENLPSSYLFDYQEKLKELFSKHGEI 481 +L V NLP+ + +LKELFS HG+I Sbjct: 117 RLFVGNLPNEVK---ETELKELFSPHGDI 142 >U23172-12|ABH03526.1| 562|Caenorhabditis elegans Hypothetical protein F25B5.7a protein. Length = 562 Score = 27.1 bits (57), Expect = 8.9 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +2 Query: 395 KLLVENLPSSYLFDYQEKLKELFSKHGEI 481 +L V NLP+ + +LKELFS HG+I Sbjct: 117 RLFVGNLPNEVK---ETELKELFSPHGDI 142 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,660,845 Number of Sequences: 27780 Number of extensions: 155493 Number of successful extensions: 555 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 555 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1113119490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -