BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11e14 (550 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g05720.1 68418.m00629 RNA recognition motif (RRM)-containing ... 31 0.38 At1g63240.1 68414.m07148 expressed protein 30 1.2 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 29 1.5 >At5g05720.1 68418.m00629 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 31.5 bits (68), Expect = 0.38 Identities = 14/32 (43%), Positives = 25/32 (78%) Frame = +2 Query: 398 LLVENLPSSYLFDYQEKLKELFSKHGEINTVK 493 ++V+NLPS ++ + E+L+++FS+ GEI VK Sbjct: 4 IIVKNLPSKHVTE--ERLRDVFSRKGEIADVK 33 >At1g63240.1 68414.m07148 expressed protein Length = 548 Score = 29.9 bits (64), Expect = 1.2 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +3 Query: 129 SW*PKRKVAELKLRQLNPSPLKMSLK-KQKFQNKPKRTMAYRIKLSMETTES 281 SW P + AEL++ + +P KM++ F PK T+ + SME+ +S Sbjct: 91 SWLPDERKAELEIGYVGGNPYKMNVNTSNDFNTNPKETVVLD-ENSMESEDS 141 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 29.5 bits (63), Expect = 1.5 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +2 Query: 398 LLVENLPSSYLFDYQEKLKELFSKHGEINTVKRGP 502 L V+N+P + E+LKELF +HGE+ + P Sbjct: 294 LYVKNIPEN---TSTEQLKELFQRHGEVTKIVTPP 325 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,087,403 Number of Sequences: 28952 Number of extensions: 143793 Number of successful extensions: 433 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 423 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 432 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -