BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11e13 (321 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1685.15c |klp6|sot2, SPBC649.01c|kinesin-like protein Klp6|S... 25 3.8 SPAC6F12.14 |cut23|apc8|anaphase-promoting complex subunit Apc8 ... 24 5.0 SPAPB1A10.05 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 24 5.0 SPAC3A12.07 |rpb11||DNA-directed RNA polymerase II complex subun... 24 6.6 SPBC1271.05c |||zinc finger protein zf-AN1 type|Schizosaccharomy... 24 6.6 SPAC2G11.11c |prh1||ATP-dependent RNA helicase Prh1|Schizosaccha... 23 8.7 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 23 8.7 SPAC1002.03c |gls2||glucosidase II Gls2|Schizosaccharomyces pomb... 23 8.7 SPAC26H5.12 |rpo41||mitochondrial DNA-directed RNA polymerase|Sc... 23 8.7 >SPBC1685.15c |klp6|sot2, SPBC649.01c|kinesin-like protein Klp6|Schizosaccharomyces pombe|chr 2|||Manual Length = 784 Score = 24.6 bits (51), Expect = 3.8 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = -3 Query: 190 CKDLQDSTVVLVARCSGKGAEMQVHRSDDNPEVNRLVDNN 71 CK Q+S +V+ G+GA+M D+ ++ + + N Sbjct: 531 CKTFQNSISHIVSSFKGEGADMYADMLQDDVDLLKSIIEN 570 >SPAC6F12.14 |cut23|apc8|anaphase-promoting complex subunit Apc8 |Schizosaccharomyces pombe|chr 1|||Manual Length = 565 Score = 24.2 bits (50), Expect = 5.0 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 207 LHSNYVTQWTISIVNLKMVRNTHLFCKMYSKLV-ANKK 317 L+ NY++ WT+ ++NTH + Y V N+K Sbjct: 367 LNRNYLSAWTLMGHEYVELKNTHAAIESYRLAVDVNRK 404 >SPAPB1A10.05 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 285 Score = 24.2 bits (50), Expect = 5.0 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 180 KSLHQHIQLLHSNYVTQW 233 +S H +I L+SNY T W Sbjct: 166 QSAHPYISSLNSNYPTTW 183 >SPAC3A12.07 |rpb11||DNA-directed RNA polymerase II complex subunit Rpb11|Schizosaccharomyces pombe|chr 1|||Manual Length = 123 Score = 23.8 bits (49), Expect = 6.6 Identities = 7/30 (23%), Positives = 20/30 (66%) Frame = +3 Query: 174 SCKSLHQHIQLLHSNYVTQWTISIVNLKMV 263 + KSL H++ + N++ +W + +++++ V Sbjct: 89 AAKSLITHLEEIKVNFMREWELKMISVEGV 118 >SPBC1271.05c |||zinc finger protein zf-AN1 type|Schizosaccharomyces pombe|chr 2|||Manual Length = 215 Score = 23.8 bits (49), Expect = 6.6 Identities = 14/49 (28%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +2 Query: 74 IVHQS-VHLRIVVRSVDLHLRSFARAACHQHNGAIL*ILASTYTAVTLK 217 I+H S VH+ + S D+ + ++ +A H H + AST K Sbjct: 63 IIHDSAVHIAPLPSSCDIDFKDYSTSAFHLHFSPLTPNHASTEAVSNFK 111 >SPAC2G11.11c |prh1||ATP-dependent RNA helicase Prh1|Schizosaccharomyces pombe|chr 1|||Manual Length = 719 Score = 23.4 bits (48), Expect = 8.7 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = -3 Query: 190 CKDLQDSTVVLVARCSGKGAEMQV 119 C+ +QD+ V++V +G G Q+ Sbjct: 106 CQQIQDNRVIVVVGETGSGKSTQI 129 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 23.4 bits (48), Expect = 8.7 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 79 PPVCSPPDCRPICGPASPLLCQSSVP 156 PPV +PP P P+ P S+P Sbjct: 415 PPVPTPPSLPPSAPPSLPPSAPPSLP 440 >SPAC1002.03c |gls2||glucosidase II Gls2|Schizosaccharomyces pombe|chr 1|||Manual Length = 923 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +3 Query: 198 IQLLHSNYVTQWTISIVNLKMVRNTHLF 281 I+ + + VT+W +S+ + +RN LF Sbjct: 894 IRKIIDSEVTEWDVSVDDSGCIRNPQLF 921 >SPAC26H5.12 |rpo41||mitochondrial DNA-directed RNA polymerase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1120 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +1 Query: 133 LLCQSSVPPTQR 168 LLCQ+S+ PTQR Sbjct: 108 LLCQASLNPTQR 119 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,299,617 Number of Sequences: 5004 Number of extensions: 24986 Number of successful extensions: 77 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 2,362,478 effective HSP length: 63 effective length of database: 2,047,226 effective search space used: 88030718 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -