BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11e11 (627 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_30649| Best HMM Match : zf-C2H2 (HMM E-Value=1.7e-24) 27 9.4 >SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 27.5 bits (58), Expect = 9.4 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Frame = -2 Query: 254 VLCTQRTETVLRFLSIKIYFMK---IVRQDLLFPHSNPSSEFL 135 V+ + T ++ FL I + F+ + +Q +LFPH PS E + Sbjct: 112 VMIGRMTIDMMYFLVIMVVFLLAYGVAQQAILFPHEKPSWELI 154 >SB_30649| Best HMM Match : zf-C2H2 (HMM E-Value=1.7e-24) Length = 463 Score = 27.5 bits (58), Expect = 9.4 Identities = 10/45 (22%), Positives = 25/45 (55%) Frame = -2 Query: 410 VTFNVNDVSTVECC*RRLEA*PKTWGGVLRSVLDWIWKSNSFPVD 276 ++++ N++ V+CC ++ +G +L ++ W + FPV+ Sbjct: 62 ISWSENELELVQCCNSSVKTNVYVFGTLLYEIMTGRWPFSHFPVE 106 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,454,543 Number of Sequences: 59808 Number of extensions: 363469 Number of successful extensions: 1019 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 924 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1014 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -