BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11e10 (688 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 22 4.8 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 22 6.3 AF134818-1|AAD40234.1| 130|Apis mellifera lambda crystallin-lik... 21 8.3 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 22.2 bits (45), Expect = 4.8 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = -3 Query: 365 QNILHXXXXXXXFISCSLTLDTLRSGK 285 QN L+ C LT+D LR K Sbjct: 353 QNKLYEETYALAPAGCDLTIDNLRKAK 379 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.8 bits (44), Expect = 6.3 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +2 Query: 68 NIKYHIETFCKPKWRCCLDRPRNLEMMRPWNI 163 N K ++ + PK CL PR++E++ N+ Sbjct: 76 NFKDVVKIWVGPKLVICLIDPRDVEIILSSNV 107 >AF134818-1|AAD40234.1| 130|Apis mellifera lambda crystallin-like protein protein. Length = 130 Score = 21.4 bits (43), Expect = 8.3 Identities = 11/41 (26%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +1 Query: 331 SNVNKVKWRMFCEKFKNIVEDYS--FGTLLRVDCKGDYSER 447 +++N + +CE +KN + D S FG + + + G+ +E+ Sbjct: 56 AHLNAEGMKKYCETYKNSIYDVSMTFGPVPKFE--GEMAEK 94 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,475 Number of Sequences: 438 Number of extensions: 4335 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -