BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11e04 (687 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 23 3.1 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 23 3.1 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 22 4.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 7.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 7.2 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 22.6 bits (46), Expect = 3.1 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +2 Query: 593 PRPLEHWFIRWL 628 P+ + WF+RWL Sbjct: 14 PQEMPTWFVRWL 25 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 22.6 bits (46), Expect = 3.1 Identities = 6/11 (54%), Positives = 11/11 (100%) Frame = +3 Query: 642 YQRLIPDGIFI 674 +QR++PDG+F+ Sbjct: 589 WQRVLPDGVFV 599 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 22.2 bits (45), Expect = 4.1 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +1 Query: 448 WCVEASDTLVILISCLLIWNASNVRSPLSEY 540 W + + ++I I CL IW+ N + Y Sbjct: 40 WYICYTIGVIITIGCLCIWSIFNKWNQFRSY 70 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.2 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -1 Query: 495 KTAY*YDESIRSFHTP*HTRNINVVDI*FIFF 400 KT YDES + H + + + F+FF Sbjct: 1302 KTNITYDESTQEVHISKEYLQLEPIGLVFVFF 1333 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.2 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -1 Query: 495 KTAY*YDESIRSFHTP*HTRNINVVDI*FIFF 400 KT YDES + H + + + F+FF Sbjct: 1302 KTNITYDESTQEVHISKEYLQLEPIGLVFVFF 1333 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,230 Number of Sequences: 336 Number of extensions: 3181 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -