BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11e04 (687 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1071.11 |||NADH-dependent flavin oxidoreductase |Schizosacch... 27 2.5 SPBC1604.14c |shk1|pak1, orb2|PAK-related kinase Shk1|Schizosacc... 26 4.4 SPCC569.07 |||aromatic aminotransferase |Schizosaccharomyces pom... 25 7.8 SPCC1259.12c |||Ran GTPase binding protein |Schizosaccharomyces ... 25 7.8 >SPAC1071.11 |||NADH-dependent flavin oxidoreductase |Schizosaccharomyces pombe|chr 1|||Manual Length = 244 Score = 27.1 bits (57), Expect = 2.5 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -3 Query: 463 KLPHTIAHAKHQCRRYIVYLLYSSACSVSHW 371 K+P A+A Q R IV+LL SS S W Sbjct: 89 KIPSRTANAIQQSNRVIVHLLSSSIKKHSEW 119 >SPBC1604.14c |shk1|pak1, orb2|PAK-related kinase Shk1|Schizosaccharomyces pombe|chr 2|||Manual Length = 658 Score = 26.2 bits (55), Expect = 4.4 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = -2 Query: 587 RRSRPRKEAPNQVKKKYSLKGDRTFDAFHIRRQLINMTRVSEASTHHST 441 R+ +P + AP +L D TF F + + ++RVS S HS+ Sbjct: 39 RKLKPSRTAPKPPAINTNLAED-TFSGFPLSQSRTTVSRVSLGSRQHSS 86 >SPCC569.07 |||aromatic aminotransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 470 Score = 25.4 bits (53), Expect = 7.8 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 554 GWEPLCGACFFGKPRPLEHWFIRW 625 G +P+CG F G+P + F R+ Sbjct: 420 GVKPVCGQLFMGEPNSADKIFFRF 443 >SPCC1259.12c |||Ran GTPase binding protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 486 Score = 25.4 bits (53), Expect = 7.8 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = +1 Query: 310 VLGIVSNVKFEVVTFDREPLANDLHYMLMSKEDKLY 417 V+G+ S+ + V F + P D+ Y + +++KL+ Sbjct: 214 VIGLKSHGEHVEVNFGQNPFLYDIDYAIQMEKNKLF 249 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,655,802 Number of Sequences: 5004 Number of extensions: 51839 Number of successful extensions: 147 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 144 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 147 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -