BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11e04 (687 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0492 - 24874517-24874960,24875672-24875815,24876214-248762... 28 6.0 11_01_0381 + 2890778-2891506 28 8.0 >03_05_0492 - 24874517-24874960,24875672-24875815,24876214-24876282, 24876452-24876570,24878292-24878580 Length = 354 Score = 28.3 bits (60), Expect = 6.0 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +3 Query: 579 ASSASPDRWSTGLYDGCC 632 A+ A+P RW+T DGCC Sbjct: 332 AAVAAPFRWATAAGDGCC 349 >11_01_0381 + 2890778-2891506 Length = 242 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -3 Query: 307 STLMPRNLATNWTSKTWRSVS-RLERKSGVLCTE 209 S L+P+ +A N SK W VS R +R++ V+C E Sbjct: 173 SLLLPKQIAKNSASK-WSLVSKRFQRRNVVVCEE 205 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,304,030 Number of Sequences: 37544 Number of extensions: 341604 Number of successful extensions: 937 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 917 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 937 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -