BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11e04 (687 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41614| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_33706| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_3045| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_41614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 938 Score = 29.5 bits (63), Expect = 2.7 Identities = 17/60 (28%), Positives = 27/60 (45%) Frame = -2 Query: 683 KNKNENAVRNKALIFPSTTAIV*TSAPAVGACRRSRPRKEAPNQVKKKYSLKGDRTFDAF 504 ++ NE K+ FP+ I A C++ P +E N + K + KG F+AF Sbjct: 72 ESNNEITPEQKSFCFPNNKVIAENPAEQSEKCKQGFPLQE-QNSFESKIAGKGCNNFEAF 130 >SB_33706| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 969 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 475 VILISCLLIWNASNVRSPLSEYF 543 ++ I+C +W A NVRSP EYF Sbjct: 342 LVFIAC--VWWAKNVRSPGQEYF 362 >SB_3045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 825 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +1 Query: 502 WNASNVRS-PLSEYFFLTWLGASLRGLLLRQ 591 WN ++R S+Y + W G S RG++ Q Sbjct: 288 WNGHSIRGMKRSQYIYAVWRGHSTRGMIRSQ 318 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,197,779 Number of Sequences: 59808 Number of extensions: 416993 Number of successful extensions: 1115 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1045 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1114 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -