BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11e04 (687 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 25 0.51 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 24 1.6 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 23 2.1 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 2.1 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 8.3 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 25.4 bits (53), Expect = 0.51 Identities = 7/22 (31%), Positives = 16/22 (72%) Frame = +1 Query: 481 LISCLLIWNASNVRSPLSEYFF 546 +I+C++IW ++++P + Y F Sbjct: 52 IITCIVIWRNPSMQTPTNYYLF 73 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 23.8 bits (49), Expect = 1.6 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +3 Query: 636 WKYQRLIPDGIFIFIF 683 WKY ++ D IF++IF Sbjct: 539 WKYVAMVLDRIFLWIF 554 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 591 SPDRWSTGLYDGCCRWKYQRLIPDGIFIFIF 683 SP R +T YD CC+ + + D + F F Sbjct: 337 SPVRPATVQYDTCCQGRATAIYIDKVSRFFF 367 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.4 bits (48), Expect = 2.1 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 118 GDAPELPKHMTFSKSDVPLIGALLDFLETSFQYIR 222 G +LP H T +S ++ DFLE F IR Sbjct: 47 GSVMQLPIHGTEPRSKEEILLHAKDFLEQYFSSIR 81 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 8.3 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -1 Query: 579 QAPQRGSQPS 550 QAPQRGS P+ Sbjct: 32 QAPQRGSPPN 41 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,109 Number of Sequences: 438 Number of extensions: 3623 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -