BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11e03 (699 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 25 0.79 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 24 1.4 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 21 7.3 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 21 9.7 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 24.6 bits (51), Expect = 0.79 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +3 Query: 444 IAYAFTCYDLLGEGHLRRETMYQLMKKSL 530 I AF+CY +L +R+ QLM K L Sbjct: 72 IVNAFSCYTVLAPVLCKRQQYCQLMSKLL 100 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 23.8 bits (49), Expect = 1.4 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 399 AKAISLYLRGDIEERIAYAFTCYDL 473 A+AI+ + G+ I A TCY+L Sbjct: 290 AQAIAFFSAGNDTTSITLALTCYEL 314 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 207 EKIMVIFFKIQKRDEKPAASDLI 275 E I++ F K +RDEKP + + I Sbjct: 385 ELIVIQFRKKMERDEKPYSRNSI 407 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 21.0 bits (42), Expect = 9.7 Identities = 9/40 (22%), Positives = 19/40 (47%) Frame = +3 Query: 297 VLHTGLGMTDSYMMERVMVALDRGTSPYVTMATFAKAISL 416 ++ TG+GMT + ++ + GT ++ IS+ Sbjct: 84 IIDTGIGMTKADLVHNLGTIAKSGTKAFMEALQAGADISM 123 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,729 Number of Sequences: 336 Number of extensions: 3338 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -