BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11d20 (681 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 23 2.7 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 21 8.2 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 216 NSDNNPQNLANSYSTNHGSCQ 278 N +NN N N+Y+TN+ Q Sbjct: 93 NYNNNYNNYNNNYNTNYKKLQ 113 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 21.4 bits (43), Expect = 8.2 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = -1 Query: 342 SMD*CSHARENHSYCDCDNRLVDNFHDL*NNCLLSSEDYYQ 220 SMD + A +S+ D+ N + ++CLL D YQ Sbjct: 80 SMDSQNSASTYNSFLSSDSASSGNVYCKCDDCLLGIVDDYQ 120 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,935 Number of Sequences: 438 Number of extensions: 3260 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -