BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11d19 (684 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 6.3 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 21 8.3 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 8.3 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 314 MQQPATPQDPGASPYPLQ 367 M+ A+P+ P ASP P + Sbjct: 732 MRGEASPRSPNASPSPAE 749 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.4 bits (43), Expect = 8.3 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -2 Query: 95 IVLFYYSTMLLIFFENIITCYCIFLN 18 I L Y + F NIITC I+ N Sbjct: 36 ITLTYVVIFVTGFVGNIITCIVIWRN 61 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/36 (27%), Positives = 14/36 (38%) Frame = -1 Query: 510 FFVKSSYSALIVANNVNQKAVASLSSLSHVPRDLWF 403 + V S AL V N + + L H +WF Sbjct: 858 YMVSPSNDALFVLNGETRTINCEIGGLQHPGAVVWF 893 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,629 Number of Sequences: 438 Number of extensions: 3790 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -