BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11d19 (684 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 28 5.0 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 27 8.8 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +2 Query: 302 PCVEMQQPATPQDPGASPYPLQPTDKIAPLP 394 P P+TP PG+ P P PT +P+P Sbjct: 530 PITVPSPPSTPTSPGSPPSPSSPTPS-SPIP 559 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 320 QPATPQDPGASPYPLQPTDKIAPLP 394 +P TP+ P P+P PT K P P Sbjct: 61 KPPTPKPPTVKPHPKPPTVKPHPKP 85 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,296,037 Number of Sequences: 28952 Number of extensions: 290960 Number of successful extensions: 715 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 689 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 714 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -