BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11d13 (708 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43495| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_55256| Best HMM Match : Lamp (HMM E-Value=0.55) 31 1.2 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 29 3.7 SB_11816| Best HMM Match : zf-piccolo (HMM E-Value=0.59) 28 6.5 SB_2894| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_39167| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_34620| Best HMM Match : KMP11 (HMM E-Value=0.59) 28 8.5 SB_7210| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 >SB_43495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1994 Score = 31.1 bits (67), Expect = 0.92 Identities = 21/79 (26%), Positives = 39/79 (49%) Frame = +1 Query: 451 ISTPWSSETWDSAVFNSANSEKTLTPKSSTSYGATTPFFSVSSKNTLTLLESAVSLNESH 630 +S ++ + S SA+ +KTLT +STS P S+++ + L++ +LN S Sbjct: 225 VSKSFTEVSVSSNTTTSASVQKTLTTSASTSLAVAQPHTSLATSSNSQALKTE-TLNSSS 283 Query: 631 VMKPTIRATQSMSSGTLSS 687 P + + SS ++S Sbjct: 284 A-SPAVSTASASSSQLVAS 301 >SB_55256| Best HMM Match : Lamp (HMM E-Value=0.55) Length = 284 Score = 30.7 bits (66), Expect = 1.2 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 8/85 (9%) Frame = +1 Query: 442 LSMISTPWSSETWDSAVFNSANSEKTLTPKSSTSYGATTP------FFSVSSKNTL--TL 597 +SM S+P S + S+V S+ S TP ++T+ TTP +SV K + L Sbjct: 55 ISMHSSPSISVSVASSVMPSSTSVAPTTPPATTTKAPTTPPKPTFGDYSVKDKQGMFCLL 114 Query: 598 LESAVSLNESHVMKPTIRATQSMSS 672 + + + N +++ K T+ MSS Sbjct: 115 AQLSATFNVTYLKKKAGNKTEEMSS 139 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 29.1 bits (62), Expect = 3.7 Identities = 18/61 (29%), Positives = 28/61 (45%) Frame = +1 Query: 484 SAVFNSANSEKTLTPKSSTSYGATTPFFSVSSKNTLTLLESAVSLNESHVMKPTIRATQS 663 + S+N E +TPKSST P S SS ++ ++S S N + + TQ Sbjct: 1766 TVALKSSNVEAKITPKSSTDAARLIPKASKSSTGSVN-VKSRSSTNATQITPKASTGTQK 1824 Query: 664 M 666 + Sbjct: 1825 V 1825 >SB_11816| Best HMM Match : zf-piccolo (HMM E-Value=0.59) Length = 351 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 153 CIETFLSTLQNYRWLINLADH 215 C +LS+L++Y WL +L DH Sbjct: 279 CNHEWLSSLRDYEWLCSLRDH 299 >SB_2894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/43 (32%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = +1 Query: 466 SSETWDSAV-FNSANSEKTLTPKSSTSYGATTPFFSVSSKNTL 591 ++ T D AV F + ++ L ++ SYGA+T FS+ + N++ Sbjct: 4 NTSTRDIAVDFQTKRQKRKLRAATAASYGASTTQFSIGTVNSM 46 >SB_39167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 960 Score = 27.9 bits (59), Expect = 8.5 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = +1 Query: 481 DSAVFNSANSEKTLTPKSSTSYGATTPFFSVSSKNTLTLLESAVSLNES 627 D+ ++N+A S +TSY TP+ S +S N T A S N + Sbjct: 572 DATLYNNATS-----CNDATSYNNATPYNSATSYNNATSCNDATSYNNA 615 >SB_34620| Best HMM Match : KMP11 (HMM E-Value=0.59) Length = 668 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -1 Query: 183 FVTSIKMFRYSCKYPFFIMDYQGIKCTYYL 94 + TS + FR SC P+F G +CT L Sbjct: 470 YPTSRRSFRVSCVLPYFQAFLSGFRCTTVL 499 >SB_7210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 869 Score = 27.9 bits (59), Expect = 8.5 Identities = 17/61 (27%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = +1 Query: 442 LSMISTPWSSETWDSAVFNSANSEKTLTPKSSTSYGATTPFF-SVSSKNTLTLLESAVSL 618 L +P+ ET++S +S S T + +STS + P SV+S ++ +S V + Sbjct: 633 LPQCPSPYPKETYESTTTDSTKSATTYSSSNSTSLQSKGPVLDSVNSCTAVSADDSLVPI 692 Query: 619 N 621 + Sbjct: 693 S 693 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,486,232 Number of Sequences: 59808 Number of extensions: 373660 Number of successful extensions: 793 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 642 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 780 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1865706635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -