BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11d13 (708 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ618927-1|CAF02006.1| 235|Anopheles gambiae odorant-binding pr... 25 1.8 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 7.1 >AJ618927-1|CAF02006.1| 235|Anopheles gambiae odorant-binding protein OBPjj7a protein. Length = 235 Score = 25.4 bits (53), Expect = 1.8 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +3 Query: 597 IRISCFAQ*KSRDEADHSSDPVDVF 671 I+ CF + +++++AD + +PVD F Sbjct: 78 IKKQCFMEVRNKNKADGAYEPVDFF 102 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.4 bits (48), Expect = 7.1 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 463 WSSETWDSAVFNSANSEKTLTPKSSTSYGATT 558 W W F ++ ++ T TPKS T GAT+ Sbjct: 466 WPDSFWR---FYNSKTKSTHTPKSITYKGATS 494 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 673,313 Number of Sequences: 2352 Number of extensions: 13221 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72340815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -