BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11d09 (456 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC83.05 |||mitochondrial RNA-binding protein |Schizosaccharomy... 25 4.2 SPAPB1E7.08c |||membrane transporter|Schizosaccharomyces pombe|c... 25 4.2 SPBC1685.15c |klp6|sot2, SPBC649.01c|kinesin-like protein Klp6|S... 25 7.3 SPAC607.10 |spo3||sporulation protein Spo3|Schizosaccharomyces p... 24 9.6 SPAPB1A10.05 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 24 9.6 SPAC1093.06c |dhc1|SPAC30C2.01c|dynein heavy chain |Schizosaccha... 24 9.6 >SPBC83.05 |||mitochondrial RNA-binding protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 773 Score = 25.4 bits (53), Expect = 4.2 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +3 Query: 240 FYSEFKNVLQVSFPETDGFSFQDIVF 317 F + K L +FP +D +DI+F Sbjct: 72 FQNNLKKQLSAAFPSSDTMQLEDIIF 97 >SPAPB1E7.08c |||membrane transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 554 Score = 25.4 bits (53), Expect = 4.2 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -3 Query: 265 KTFLNSL*KSSIALHNLSVTAVYVDARIYRIAPLC 161 KT+ NSL S+I + + V V+ RI R LC Sbjct: 407 KTYRNSLIVSAIGVPGSLIAGVLVEFRIGRKGTLC 441 >SPBC1685.15c |klp6|sot2, SPBC649.01c|kinesin-like protein Klp6|Schizosaccharomyces pombe|chr 2|||Manual Length = 784 Score = 24.6 bits (51), Expect = 7.3 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = -2 Query: 191 CKDLQDSTVVLVARCSGKGAEMQVHRSDDNPEVNRLVDNN 72 CK Q+S +V+ G+GA+M D+ ++ + + N Sbjct: 531 CKTFQNSISHIVSSFKGEGADMYADMLQDDVDLLKSIIEN 570 >SPAC607.10 |spo3||sporulation protein Spo3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1028 Score = 24.2 bits (50), Expect = 9.6 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 365 NRQFQFCYPTSRVRCNENNILKR 297 N ++FC SR ++N +LKR Sbjct: 776 NEIYEFCGTHSRAEVHKNEVLKR 798 >SPAPB1A10.05 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 285 Score = 24.2 bits (50), Expect = 9.6 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 181 KSLHQHIQLLHSNYVTQW 234 +S H +I L+SNY T W Sbjct: 166 QSAHPYISSLNSNYPTTW 183 >SPAC1093.06c |dhc1|SPAC30C2.01c|dynein heavy chain |Schizosaccharomyces pombe|chr 1|||Manual Length = 4196 Score = 24.2 bits (50), Expect = 9.6 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -3 Query: 358 NFSFAIQLLEYVVMKTIS*KENPSV-SGKETCKTFLNSL 245 NF+ +I LLE ++K++ + P V K+ C T S+ Sbjct: 3614 NFTLSISLLETQMLKSVISVQEPGVFKQKDNCFTLKLSI 3652 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,773,531 Number of Sequences: 5004 Number of extensions: 35286 Number of successful extensions: 105 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 170285640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -