BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11c22 (554 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 27 0.096 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 27 0.096 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 27 0.096 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 27 0.13 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 27 0.13 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 27 0.13 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 27 0.13 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 27 0.13 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 27 0.13 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 27 0.13 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 27 0.13 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 27 0.13 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 26 0.29 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 26 0.29 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 26 0.29 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 26 0.29 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 26 0.29 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 26 0.29 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 26 0.29 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 26 0.29 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 26 0.29 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 26 0.29 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 26 0.29 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 25 0.39 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 25 0.39 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 25 0.39 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 25 0.68 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 25 0.68 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 24 1.2 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 24 1.2 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 24 1.2 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 24 1.2 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 24 1.2 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 2.1 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.1 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 22 3.6 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 6.3 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 21 6.3 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 27.5 bits (58), Expect = 0.096 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = +1 Query: 301 TVSRVGSPCDCARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 T SR C+R ++++ R ++R K H ++ K ++R+S R+ Sbjct: 227 TSSRYSRERSCSRDRNREYRKKDRRYEKLHNEK-EKLLEERTSRKRY 272 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 27.5 bits (58), Expect = 0.096 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = +1 Query: 301 TVSRVGSPCDCARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 T SR C+R ++++ R ++R K H ++ K ++R+S R+ Sbjct: 232 TSSRYSRERSCSRDRNREYRKKDRRYEKLHNEK-EKLLEERTSRKRY 277 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 27.5 bits (58), Expect = 0.096 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = +1 Query: 301 TVSRVGSPCDCARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 T SR C+R ++++ R ++R K H ++ K ++R+S R+ Sbjct: 227 TSSRYSRERSCSRDRNREYRKKDRRYEKLHNEK-EKLLEERTSRERY 272 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 27.1 bits (57), Expect = 0.13 Identities = 11/37 (29%), Positives = 24/37 (64%) Frame = +1 Query: 331 CARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 C+R ++++ R N+R K H ++ K ++R+S +R+ Sbjct: 4 CSRDRNREYREKNRRYEKLHNEK-EKLLEERTSRNRY 39 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 27.1 bits (57), Expect = 0.13 Identities = 11/37 (29%), Positives = 24/37 (64%) Frame = +1 Query: 331 CARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 C+R ++++ R N+R K H ++ K ++R+S +R+ Sbjct: 4 CSRDRNREYREKNRRYEKLHNEK-EKLLEERTSRNRY 39 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 27.1 bits (57), Expect = 0.13 Identities = 11/37 (29%), Positives = 24/37 (64%) Frame = +1 Query: 331 CARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 C+R ++++ R N+R K H ++ K ++R+S +R+ Sbjct: 4 CSRDRNREYREKNRRYEKLHNEK-EKLLEERTSRNRY 39 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 27.1 bits (57), Expect = 0.13 Identities = 11/37 (29%), Positives = 24/37 (64%) Frame = +1 Query: 331 CARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 C+R ++++ R N+R K H ++ K ++R+S +R+ Sbjct: 4 CSRDRNREYREKNRRYEKLHNEK-EKLLEERTSRNRY 39 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 27.1 bits (57), Expect = 0.13 Identities = 11/37 (29%), Positives = 24/37 (64%) Frame = +1 Query: 331 CARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 C+R ++++ R N+R K H ++ K ++R+S +R+ Sbjct: 4 CSRDRNREYREKNRRYEKLHNEK-EKLLEERTSRNRY 39 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 27.1 bits (57), Expect = 0.13 Identities = 11/37 (29%), Positives = 24/37 (64%) Frame = +1 Query: 331 CARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 C+R ++++ R N+R K H ++ K ++R+S +R+ Sbjct: 4 CSRDRNREYREKNRRYEKLHNEK-EKLLEERTSRNRY 39 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 27.1 bits (57), Expect = 0.13 Identities = 11/37 (29%), Positives = 24/37 (64%) Frame = +1 Query: 331 CARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 C+R ++++ R N+R K H ++ K ++R+S +R+ Sbjct: 4 CSRDRNREYREKNRRYEKLHNEK-EKLLEERTSRNRY 39 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 27.1 bits (57), Expect = 0.13 Identities = 12/47 (25%), Positives = 27/47 (57%) Frame = +1 Query: 301 TVSRVGSPCDCARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 T SR C+R ++++ + ++R K H ++ +K ++R+S R+ Sbjct: 227 TSSRYSRERSCSRDRNREYKKKDRRYEKLHNEK-KKLLEERTSRKRY 272 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 27.1 bits (57), Expect = 0.13 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = +1 Query: 301 TVSRVGSPCDCARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 T SR C+R ++++ R ++R K H ++ K ++R+S R+ Sbjct: 227 TSSRYSRERSCSRDRNREYREKDRRYEKLHNEK-EKLLEERTSRKRY 272 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 25.8 bits (54), Expect = 0.29 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = +1 Query: 301 TVSRVGSPCDCARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 T SR C+R ++++ + ++R K H ++ K ++R+S R+ Sbjct: 216 TSSRYSRERSCSRDRNREYKEKDRRYEKLHNEK-EKLLEERTSRKRY 261 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 25.8 bits (54), Expect = 0.29 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = +1 Query: 301 TVSRVGSPCDCARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 T SR C+R ++++ R +++ K H ++ K ++R+S R+ Sbjct: 216 TSSRYSRERSCSRDRNREYRKKDRQYEKLHNEK-EKLLEERTSRKRY 261 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 25.8 bits (54), Expect = 0.29 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = +1 Query: 301 TVSRVGSPCDCARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 T SR C+R ++++ R ++R K H ++ K ++R+S R+ Sbjct: 227 TSSRYSRERSCSRDRNREYRKKDRRYEKLHNEK-EKLLEERTSCKRY 272 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.8 bits (54), Expect = 0.29 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = +1 Query: 301 TVSRVGSPCDCARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 T SR C+R ++++ R +++ K H ++ K ++R+S R+ Sbjct: 227 TSSRYSRERSCSRDRNREYRKKDRQYEKLHNEK-EKLLEERTSRKRY 272 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 25.8 bits (54), Expect = 0.29 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = +1 Query: 301 TVSRVGSPCDCARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 T SR C+R ++++ + ++R K H ++ K ++R+S R+ Sbjct: 227 TSSRYSRERSCSRDRNREYKEKDRRYEKLHNEK-EKLLEERTSRKRY 272 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 25.8 bits (54), Expect = 0.29 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = +1 Query: 301 TVSRVGSPCDCARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 T SR C+R ++++ R +++ K H ++ K ++R+S R+ Sbjct: 216 TSSRYSRERSCSRDRNREYRKKDRQYEKLHNEK-EKLLEERTSRKRY 261 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 25.8 bits (54), Expect = 0.29 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = +1 Query: 301 TVSRVGSPCDCARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 T SR C+R ++++ R +++ K H ++ K ++R+S R+ Sbjct: 227 TSSRYSRERSCSRDRNREYRKKDRQYEKLHNEK-EKLLEERTSRKRY 272 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 25.8 bits (54), Expect = 0.29 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = +1 Query: 301 TVSRVGSPCDCARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 T SR C+R ++++ R +++ K H ++ K ++R+S R+ Sbjct: 227 TSSRYSRERSCSRDRNREYRKKDRQYEKLHNEK-EKLLEERTSRKRY 272 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 25.8 bits (54), Expect = 0.29 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = +1 Query: 301 TVSRVGSPCDCARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 T SR C+R ++++ R +++ K H ++ K ++R+S R+ Sbjct: 216 TSSRYSRERSCSRDRNREYRKKDRQYEKLHNEK-EKLLEERTSRKRY 261 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 25.8 bits (54), Expect = 0.29 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = +1 Query: 301 TVSRVGSPCDCARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 T SR C+R ++++ R +++ K H ++ K ++R+S R+ Sbjct: 216 TSSRYSRERSCSRDRNREYRKKDRQYEKLHNEK-EKLLEERTSRKRY 261 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 25.8 bits (54), Expect = 0.29 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = +1 Query: 301 TVSRVGSPCDCARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 T SR C+R ++++ + ++R K H ++ K ++R+S R+ Sbjct: 227 TSSRYSRERSCSRDRNREYKEKDRRYEKLHNEK-EKLLEERTSRKRY 272 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 25.4 bits (53), Expect = 0.39 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = +1 Query: 301 TVSRVGSPCDCARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 T SR C+R ++++ R +++ K H ++ K ++R+S R+ Sbjct: 227 TSSRYSRERSCSRDRNREYRKKDRQYEKLHNEK-EKFLEERTSHKRY 272 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 25.4 bits (53), Expect = 0.39 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = +1 Query: 301 TVSRVGSPCDCARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 T SR C+R ++++ R +++ K H ++ K ++R+S R+ Sbjct: 227 TSSRYSRERSCSRDRNREYRKKDRQYEKLHNEK-EKFLEERTSRKRY 272 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 25.4 bits (53), Expect = 0.39 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = +1 Query: 301 TVSRVGSPCDCARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 T SR C+R ++++ R +++ K H ++ K ++R+S R+ Sbjct: 227 TSSRYSRERSCSRDRNREYRKKDRQYEKLHNEK-EKFLEERTSRKRY 272 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 24.6 bits (51), Expect = 0.68 Identities = 16/56 (28%), Positives = 29/56 (51%) Frame = +1 Query: 343 QSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRWRPHKKCCVIL*KTSKKNIMYLSN 510 +S++ ++ ++ K +RK R+ K+RS + R R K I+ S I +SN Sbjct: 41 RSREREQNSYKNEKEYRK-YRERSKERSRDKRERERSKERKIISSLSNNYISNISN 95 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 24.6 bits (51), Expect = 0.68 Identities = 16/56 (28%), Positives = 29/56 (51%) Frame = +1 Query: 343 QSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRWRPHKKCCVIL*KTSKKNIMYLSN 510 +S++ ++ ++ K +RK R+ K+RS + R R K I+ S I +SN Sbjct: 41 RSREREQNSYKNEKEYRK-YRERSKERSRDKRERERSKERKIISSLSNNYISNISN 95 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 1.2 Identities = 12/47 (25%), Positives = 25/47 (53%) Frame = +1 Query: 301 TVSRVGSPCDCARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 T S C+R ++++ R ++R K H ++ K ++R+S R+ Sbjct: 227 TSSHYSRERSCSRDRNREYRKKDRRYEKLHNEK-EKLLEERTSCKRY 272 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 1.2 Identities = 12/47 (25%), Positives = 25/47 (53%) Frame = +1 Query: 301 TVSRVGSPCDCARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 T S C+R ++++ R ++R K H ++ K ++R+S R+ Sbjct: 227 TSSHYSRERSCSRDRNREYRKKDRRYEKLHNEK-EKLLEERTSCKRY 272 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 1.2 Identities = 12/47 (25%), Positives = 25/47 (53%) Frame = +1 Query: 301 TVSRVGSPCDCARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 T S C+R ++++ R ++R K H ++ K ++R+S R+ Sbjct: 227 TSSHYSRERSCSRDRNREYRKKDRRYEKLHNEK-EKLLEERTSCKRY 272 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 1.2 Identities = 12/47 (25%), Positives = 25/47 (53%) Frame = +1 Query: 301 TVSRVGSPCDCARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 T S C+R ++++ R ++R K H ++ K ++R+S R+ Sbjct: 227 TSSHYSRERSCSRDRNREYRKKDRRYEKLHNEK-EKLLEERTSCKRY 272 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.8 bits (49), Expect = 1.2 Identities = 12/47 (25%), Positives = 25/47 (53%) Frame = +1 Query: 301 TVSRVGSPCDCARIQSKDSRLSNKRSRKTHRKRIRKAYKQRSSESRW 441 T S C+R ++++ R ++R K H ++ K ++R+S R+ Sbjct: 216 TSSHYSRERSCSRDRNREYRKKDRRYEKLHNEK-EKLLEERTSCKRY 261 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 23.0 bits (47), Expect = 2.1 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = -2 Query: 274 CV*YTFYSTCLVLDRAGVGACGDAHCMLAQIYMVLSCL*SVQNTC 140 CV L+ + +G + G C L + VLSC S+ N C Sbjct: 89 CVALLVMPMALLYEISGNWSFGTIMCDLWVSFDVLSCTASILNLC 133 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 2.1 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 22 PWKGNYSNNSRFTLKFIP 75 P +GN N+++ LKF P Sbjct: 871 PLEGNLMINNKYALKFFP 888 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 22.2 bits (45), Expect = 3.6 Identities = 7/30 (23%), Positives = 18/30 (60%) Frame = +2 Query: 26 GKETIVTIHDLP*NLYLWCKILKSAEYLGP 115 G+ ++ ++++P + + C+I E+L P Sbjct: 44 GQTPLIKLNNIPKSYGIKCEIYAKCEFLNP 73 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.4 bits (43), Expect = 6.3 Identities = 9/36 (25%), Positives = 20/36 (55%) Frame = +2 Query: 314 WGLLATAPEFSPKTRDLVTNVPEKHIENVFEKLTNN 421 WG L+T EF+ + + ++++ E+ + K+ N Sbjct: 864 WGHLSTLVEFALELKKALSSINEQSFNHFVLKMGIN 899 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.4 bits (43), Expect = 6.3 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = +2 Query: 254 IKSVSNARANVPAPWTQLVAWGLLATAPEFSPKTRDL 364 I S+ R + + W AT PE + + RDL Sbjct: 326 ISSLDEIRTRYKDSSSSVEGWENRATIPELNEEFRDL 362 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,457 Number of Sequences: 438 Number of extensions: 3427 Number of successful extensions: 62 Number of sequences better than 10.0: 38 Number of HSP's better than 10.0 without gapping: 62 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 62 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15949830 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -