BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11c19 (755 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 7.1 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 9.4 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 205 PKSMKVPKNRTSNAFEESKQMLKEIKVTNEEAKS 306 P+ + +N A E +LKEIK+ ++ KS Sbjct: 475 PQVETILQNACFCARNELMMILKEIKIITDQLKS 508 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = +2 Query: 350 LGERKIG*VFR*FRMEPRSPQSRFLTKKAFLMMW 451 +G+R I + FRME ++ ++ + F++ W Sbjct: 437 MGKRNIKAQVKRFRMETKAAKTLGIIVGGFILCW 470 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,988 Number of Sequences: 438 Number of extensions: 4533 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23753925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -