BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11c17 (711 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41182| Best HMM Match : PAN (HMM E-Value=0.00063) 28 6.5 SB_35886| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_13920| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_41182| Best HMM Match : PAN (HMM E-Value=0.00063) Length = 258 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +1 Query: 595 DSEDTRPRIYLDETWVNQNHSRKRIWLDKDGQGG 696 D RP + W+N R+R++ D D GG Sbjct: 132 DLRKVRPSLASGYYWINTKRKRRRVYCDMDRFGG 165 >SB_35886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 481 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -3 Query: 682 PCLAKFVCGCDFGSPKSHLNKFLVEC 605 PC K C C GS ++ LN L+EC Sbjct: 341 PCNKKINCQCICGSNEASLNDSLLEC 366 >SB_13920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 407 Score = 27.9 bits (59), Expect = 8.6 Identities = 26/84 (30%), Positives = 42/84 (50%), Gaps = 1/84 (1%) Frame = -2 Query: 446 NPSILSVALLKILAVEGYSPSQ*NDDTICLITLLSKSSNAVTVQGRL-MLSRGELTSPFT 270 NPSIL+ + + L+ S + + D +T L + AV QG L MLS+G++ T Sbjct: 268 NPSILATGVTEKLS----SVALLSADNANTVTELWEKIRAVADQGGLVMLSKGQVEDVNT 323 Query: 269 HSFLILSTVLTLTPHIAAASSRER 198 + +STV+ P A ++ R Sbjct: 324 LAVDFVSTVVNTIPVANAVATGAR 347 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,681,894 Number of Sequences: 59808 Number of extensions: 436638 Number of successful extensions: 963 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 884 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 963 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -