BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11c17 (711 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 24 1.2 L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. 23 2.2 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 2.2 AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. 23 2.9 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 8.7 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 21 8.7 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 571 LRKLKTLRDSEDTRPRIYLDETWVNQNHS 657 L KL T+ D++ + R YLD QN+S Sbjct: 560 LGKLSTIEDADKNQCRHYLDAKSSVQNYS 588 >L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. Length = 149 Score = 23.4 bits (48), Expect = 2.2 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 628 DETWVNQNHSRKRIW 672 DE WV N RKR W Sbjct: 32 DEKWVVNNIKRKRWW 46 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.4 bits (48), Expect = 2.2 Identities = 19/74 (25%), Positives = 30/74 (40%), Gaps = 8/74 (10%) Frame = +1 Query: 238 VRTVDKIKNECVKGEVS--------SPRESINRPCTVTALDDFDKSVIKQIVSSFYCDGE 393 ++ D I N ++GE S SP E T+TA + Q +S Y Sbjct: 721 LKRTDIIHNYIMRGEASPRSPNASPSPAEQCASTTTITARSPQGSQGLLQCATSNYSTTR 780 Query: 394 YPSTAKILSRATER 435 +P+T+ I + R Sbjct: 781 WPATSVITTTTGAR 794 >AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. Length = 104 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -3 Query: 568 IVAAHKRCQSFPSIVYD 518 I H C S P +VYD Sbjct: 11 IAIVHASCASVPKVVYD 27 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 467 IEVMEHWNPSILSVALLKIL 408 IE++EHW P + + L IL Sbjct: 496 IELIEHWMPLLPNWILENIL 515 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = -1 Query: 138 NIVDNNTCLCLLLKCFEFVVGTNICQ 61 +IV + +CLL + + ++G + CQ Sbjct: 5 HIVGASVLICLLNETAKAIIGVDECQ 30 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,165 Number of Sequences: 438 Number of extensions: 4025 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -