BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11c15 (685 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) 33 0.16 SB_44720| Best HMM Match : Helicase_C (HMM E-Value=0.59) 29 2.7 SB_12805| Best HMM Match : LicD (HMM E-Value=9.7e-06) 29 2.7 SB_23757| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_28816| Best HMM Match : PAS (HMM E-Value=0.0047) 29 4.6 SB_1181| Best HMM Match : DUF1604 (HMM E-Value=0) 28 6.1 SB_51159| Best HMM Match : DUF1140 (HMM E-Value=2.3) 28 8.1 SB_41830| Best HMM Match : S4 (HMM E-Value=1.6e-12) 28 8.1 SB_22969| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_18879| Best HMM Match : Pkinase_Tyr (HMM E-Value=7e-36) 28 8.1 >SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) Length = 210 Score = 33.5 bits (73), Expect = 0.16 Identities = 26/93 (27%), Positives = 45/93 (48%) Frame = +2 Query: 347 IFVQGSQEAKEDDHDVFASQFFHTYSLPVNSSAADVTAELTSDGYLVVTAPISENVDKTK 526 I + G ++ E +H S+F +Y+LP + V++ +T DG L + A +E + Sbjct: 64 IKIDGKHKS-EGEHGYETSEFHRSYNLPDGVDVSTVSSRITGDGLLHIEALKAE----PQ 118 Query: 527 NTERVVPIVETGAPYKKDEPVEKTTVETLDVST 625 TE + TG+ + +K TLDVS+ Sbjct: 119 ETEVSLVGASTGSAGDIAKIDDKRFTVTLDVSS 151 >SB_44720| Best HMM Match : Helicase_C (HMM E-Value=0.59) Length = 625 Score = 29.5 bits (63), Expect = 2.7 Identities = 18/51 (35%), Positives = 25/51 (49%) Frame = +2 Query: 419 YSLPVNSSAADVTAELTSDGYLVVTAPISENVDKTKNTERVVPIVETGAPY 571 YS+ S + SD YL+ TA +SE +D + R V I TG P+ Sbjct: 171 YSITRGHSVMSEHLNIISDRYLLFTAQVSEGLDFSDINGRAVVI--TGLPF 219 >SB_12805| Best HMM Match : LicD (HMM E-Value=9.7e-06) Length = 371 Score = 29.5 bits (63), Expect = 2.7 Identities = 20/62 (32%), Positives = 26/62 (41%) Frame = -2 Query: 258 ILGPMSTKVGISFHKGANRLNGERFSHGNVNWSSVMETGCAITSLSRAGKAVTVAKPAKA 79 I+GP+ K G F R G F NW V+ T T +S A + V +PA Sbjct: 217 IMGPLWFKHGDIFPVARLRFEGFMFDVPR-NWKQVLRTLYGRTGISAAVPTLMVVEPAPT 275 Query: 78 MK 73 K Sbjct: 276 QK 277 >SB_23757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2834 Score = 28.7 bits (61), Expect = 4.6 Identities = 17/59 (28%), Positives = 26/59 (44%) Frame = +2 Query: 422 SLPVNSSAADVTAELTSDGYLVVTAPISENVDKTKNTERVVPIVETGAPYKKDEPVEKT 598 ++PVN+ A G +VT ++ V + T V P+V A K EP +T Sbjct: 1250 TMPVNTQAVVANMVTQPHGTTIVTPAVANMVTQPHGTTIVTPVVTQSAVATK-EPARRT 1307 >SB_28816| Best HMM Match : PAS (HMM E-Value=0.0047) Length = 405 Score = 28.7 bits (61), Expect = 4.6 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = -1 Query: 265 SVDSWPDVHKSGDQLPQRSKQTEWRKVQPWEREL--VICNGDGLRD 134 +V S+ + KSG +P R++ T +R PW +E+ ++C D L + Sbjct: 135 AVSSYRFLCKSGHYIPLRTRSTLFR--NPWTKEIEFLVCTNDVLTE 178 >SB_1181| Best HMM Match : DUF1604 (HMM E-Value=0) Length = 1035 Score = 28.3 bits (60), Expect = 6.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 359 GSQEAKEDDHDVFASQFFHTYSLPVNSSAA 448 G+ +E+D DV+A Y +P N SAA Sbjct: 245 GTGVFEEEDDDVYAQDIMSNYDIPKNISAA 274 >SB_51159| Best HMM Match : DUF1140 (HMM E-Value=2.3) Length = 444 Score = 27.9 bits (59), Expect = 8.1 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +2 Query: 137 AQPVSITDDQFTFPWLNLSPFSLFAPLWKLIPTFVDIGP 253 + P + T DQ + + + SPFS APL P FVD P Sbjct: 219 SSPETFTSDQLSPTYSSPSPFSSKAPL----PVFVDFTP 253 >SB_41830| Best HMM Match : S4 (HMM E-Value=1.6e-12) Length = 275 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 258 ILGPMSTKVGISFHKGANRLNGERFSH 178 + G T+VGI H G NR+ + F H Sbjct: 209 VAGEKKTEVGIKIHSGRNRIVRKIFEH 235 >SB_22969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 817 Score = 27.9 bits (59), Expect = 8.1 Identities = 19/63 (30%), Positives = 28/63 (44%) Frame = +2 Query: 383 DHDVFASQFFHTYSLPVNSSAADVTAELTSDGYLVVTAPISENVDKTKNTERVVPIVETG 562 D DV+A Q YS PV + + + G L T + +KT+N + I+E Sbjct: 61 DFDVYAHQSETEYSGPVPDPNSRPSGTYSKIGTLNATKLWTSFGNKTQNVQTFSLILENS 120 Query: 563 APY 571 PY Sbjct: 121 KPY 123 >SB_18879| Best HMM Match : Pkinase_Tyr (HMM E-Value=7e-36) Length = 617 Score = 27.9 bits (59), Expect = 8.1 Identities = 19/63 (30%), Positives = 27/63 (42%) Frame = +2 Query: 383 DHDVFASQFFHTYSLPVNSSAADVTAELTSDGYLVVTAPISENVDKTKNTERVVPIVETG 562 D DV+A Q YS PV + + G L T +KT+N + + I+E Sbjct: 137 DFDVYAHQSETQYSGPVPDPNNSPSGTCSKIGTLNATELSPSLGNKTQNVQTLSLILENS 196 Query: 563 APY 571 PY Sbjct: 197 KPY 199 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,570,780 Number of Sequences: 59808 Number of extensions: 320950 Number of successful extensions: 1066 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 986 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1066 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -