BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11c14 (771 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin prot... 26 0.45 AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin prot... 26 0.45 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 24 1.4 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 22 5.5 >AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin protein. Length = 339 Score = 25.8 bits (54), Expect = 0.45 Identities = 14/55 (25%), Positives = 28/55 (50%) Frame = +2 Query: 605 NKLEADWSQFADTHFAVKKRGKKEVKNSIENVEENVPMEVDSSKQEEPIETFEPY 769 ++L +W + A F RGKK + +++E +++ M+ Q + TF+ Y Sbjct: 172 DELLGEWEKRAPMGF-YGTRGKKIILDALEELDKRGVMDFQIGLQRKKDTTFDDY 225 >AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin protein. Length = 301 Score = 25.8 bits (54), Expect = 0.45 Identities = 14/55 (25%), Positives = 28/55 (50%) Frame = +2 Query: 605 NKLEADWSQFADTHFAVKKRGKKEVKNSIENVEENVPMEVDSSKQEEPIETFEPY 769 ++L +W + A F RGKK + +++E +++ M+ Q + TF+ Y Sbjct: 172 DELLGEWEKRAPMGF-YGTRGKKIILDALEELDKRGVMDFQIGLQRKKDTTFDDY 225 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 24.2 bits (50), Expect = 1.4 Identities = 10/40 (25%), Positives = 23/40 (57%) Frame = +2 Query: 608 KLEADWSQFADTHFAVKKRGKKEVKNSIENVEENVPMEVD 727 +++ W F D +F ++ + +++ N + NVP++VD Sbjct: 33 QVKYQWKYF-DYNFGSDEKRQAAIQSGEYNYKNNVPIDVD 71 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/32 (25%), Positives = 20/32 (62%) Frame = +2 Query: 641 THFAVKKRGKKEVKNSIENVEENVPMEVDSSK 736 TH ++K + ++N +E ++ VP+ ++S+ Sbjct: 52 THNELEKNRRAHLRNCLEKLKVLVPLGPETSR 83 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,652 Number of Sequences: 438 Number of extensions: 3096 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24154023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -