BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11c13 (784 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase comple... 27 4.0 SPBC21B10.03c |||ataxin-2 homolog|Schizosaccharomyces pombe|chr ... 27 4.0 SPAC24C9.11 |||MIF4G/MA4 domain protein|Schizosaccharomyces pomb... 26 7.0 SPAC1751.01c |gti1||gluconate transporter inducer Gti1|Schizosac... 25 9.3 SPAC1687.11 |spb1||rRNA methyltransferase Spb1 |Schizosaccharomy... 25 9.3 >SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase complex subunit Pst1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1522 Score = 26.6 bits (56), Expect = 4.0 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 5/50 (10%) Frame = -2 Query: 507 PAVNNWRSLALLQKTG-----RPLAPSTTQVNKASSPLFTVTPPPGARIQ 373 PA ++ S+ + Q + +P APST Q N + SP PP A ++ Sbjct: 295 PAAASYTSMNMKQSSASHPVLQPPAPSTLQFNPSPSPAAPSYPPVDASVK 344 >SPBC21B10.03c |||ataxin-2 homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 791 Score = 26.6 bits (56), Expect = 4.0 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +1 Query: 331 VYGQLSRRCRAQRSLDASSGRRRN 402 +YG SRR +QRS ++S+G+R N Sbjct: 708 MYGD-SRRSNSQRSFNSSNGKRSN 730 >SPAC24C9.11 |||MIF4G/MA4 domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 775 Score = 25.8 bits (54), Expect = 7.0 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +2 Query: 614 VIKSVKPSDAGLYMCELNTEPPVRSFHRLTVISRGLTPPENRNITD 751 +++ + SD+ + N P R + ISRG ENR IT+ Sbjct: 16 ILEEIGESDSSARRGKRNHNLPHREKRKFARISRGKNGYENRKITE 61 >SPAC1751.01c |gti1||gluconate transporter inducer Gti1|Schizosaccharomyces pombe|chr 1|||Manual Length = 720 Score = 25.4 bits (53), Expect = 9.3 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 450 APSTTQVNKASSPLFTVTPPPGARIQASLGSTSS 349 +PSTT V+ AS+ + P + S+ STSS Sbjct: 217 SPSTTNVSNASTSSAPINPRAPQTRRESISSTSS 250 >SPAC1687.11 |spb1||rRNA methyltransferase Spb1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 802 Score = 25.4 bits (53), Expect = 9.3 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 298 RTQNFSGEYKYVYGQLSRRCRAQRSLDASSGRR 396 R + G+YK V ++ + RAQ+ L A GRR Sbjct: 771 RPKGVKGKYKMVDSRMKKDLRAQKRL-AKKGRR 802 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,040,907 Number of Sequences: 5004 Number of extensions: 58904 Number of successful extensions: 197 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 189 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 197 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 379359666 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -