BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11c11 (681 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27640.1 68416.m03452 transducin family protein / WD-40 repea... 32 0.40 At5g41810.2 68418.m05091 expressed protein 31 0.93 At1g48490.1 68414.m05420 protein kinase, putative similar to inc... 31 0.93 At2g04330.1 68415.m00429 hypothetical protein contains Pfam prof... 30 1.6 At3g09010.1 68416.m01055 protein kinase family protein contains ... 29 2.8 At1g54560.1 68414.m06222 myosin, putative similar to myosin GI:4... 27 8.7 At1g20450.2 68414.m02549 dehydrin (ERD10) identical to dehydrin ... 27 8.7 At1g20450.1 68414.m02548 dehydrin (ERD10) identical to dehydrin ... 27 8.7 >At3g27640.1 68416.m03452 transducin family protein / WD-40 repeat family protein contains seven WD-40 G-protein beta repeats; similar to RA-regulated nuclear matrix-associated protein (GI:14161320) {Homo sapiens} Length = 535 Score = 31.9 bits (69), Expect = 0.40 Identities = 17/65 (26%), Positives = 31/65 (47%) Frame = +1 Query: 79 KQRTDSGSDKNYQLQNKMGLVNSKDFLKKKVDEATSNSSLSNLRYVITEKPKWKVFKKRE 258 ++ + SD +Y M ++ + + KKK ++S SSLS+ +I E+ F Sbjct: 454 QKHSSLSSDDDYNNDQSMPIIRTPESQKKKTSSSSSLSSLSSEEDIICERTPETTFNSPS 513 Query: 259 AVAIP 273 +V P Sbjct: 514 SVLNP 518 >At5g41810.2 68418.m05091 expressed protein Length = 279 Score = 30.7 bits (66), Expect = 0.93 Identities = 15/49 (30%), Positives = 30/49 (61%) Frame = +1 Query: 91 DSGSDKNYQLQNKMGLVNSKDFLKKKVDEATSNSSLSNLRYVITEKPKW 237 DS S + +++ K+ + N+K +KK + T+N++LSN+++ T W Sbjct: 68 DSPSSSSLEMKKKLEIENTKKEEEKKKE--TNNNNLSNMKHKKTSSHVW 114 >At1g48490.1 68414.m05420 protein kinase, putative similar to incomplete root hair elongation (IRE) [Arabidopsis thaliana] gi|6729346|dbj|BAA89783 Length = 878 Score = 30.7 bits (66), Expect = 0.93 Identities = 23/61 (37%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = +1 Query: 124 NKMGLVNSKDFLKKKVDEATSNSSLSNLRYVITEKPKWKVF-KKREAVAIPAYTALKPLK 300 +K+GL+N+ D L V ATS ++ EKPK KR AV P Y A + L Sbjct: 616 SKVGLINNTDDLSGPVSSATS--------LLVEEKPKLPTLDHKRSAVGTPDYLAPEILL 667 Query: 301 G 303 G Sbjct: 668 G 668 >At2g04330.1 68415.m00429 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 564 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/62 (30%), Positives = 29/62 (46%) Frame = +1 Query: 250 KREAVAIPAYTALKPLKGCPCGNSGPCKQKVTPKGVTIHYPQKKKKFSAFGTKSRRNIPG 429 KR+ + PA T + +K + K+KV K + P KK+K A K++ P Sbjct: 12 KRKEIEAPAPTKTEKVKA----PAEKVKEKVPAKKAKVQAPAKKEKVQAPAKKAKVQAPA 67 Query: 430 KT 435 KT Sbjct: 68 KT 69 >At3g09010.1 68416.m01055 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 393 Score = 29.1 bits (62), Expect = 2.8 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +2 Query: 299 KVVRVVTAVLANKKSRPKESQYIIRRKKRNFPHSAQNLDGTYRG 430 KV T A K+ K+ ++RRK+ N A G YRG Sbjct: 293 KVALFCTQAAAQKRPNMKQVMEMLRRKELNLNEDALTEPGVYRG 336 >At1g54560.1 68414.m06222 myosin, putative similar to myosin GI:433663 from [Arabidopsis thaliana] Length = 1529 Score = 27.5 bits (58), Expect = 8.7 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +1 Query: 136 LVNSKDFLKKKVDEATSNSSLSNLRYVITEKPKWKVFKKREA 261 L +KD L+KKV+E T + L V E+ K + KK ++ Sbjct: 890 LKEAKDMLEKKVEELTYRAQLEKRSRVDLEEEKNQEIKKLQS 931 >At1g20450.2 68414.m02549 dehydrin (ERD10) identical to dehydrin ERD10 (Low-temperature-induced protein LTI45) [Arabidopsis thaliana] SWISS-PROT:P42759 Length = 259 Score = 27.5 bits (58), Expect = 8.7 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 1/69 (1%) Frame = +1 Query: 292 PLKGCPCGNSGPCKQKV-TPKGVTIHYPQKKKKFSAFGTKSRRNIPGKTEKGPYAPNQRV 468 PL P G+ P + P V H P++++K F K + +PG ++K + Sbjct: 154 PLGEKPGGDDVPVVTTMPAPHSVEDHKPEEEEK-KGFMDKIKEKLPGHSKKPEDSQVVNT 212 Query: 469 TPNVKVIRP 495 TP V+ P Sbjct: 213 TPLVETATP 221 >At1g20450.1 68414.m02548 dehydrin (ERD10) identical to dehydrin ERD10 (Low-temperature-induced protein LTI45) [Arabidopsis thaliana] SWISS-PROT:P42759 Length = 260 Score = 27.5 bits (58), Expect = 8.7 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 1/69 (1%) Frame = +1 Query: 292 PLKGCPCGNSGPCKQKV-TPKGVTIHYPQKKKKFSAFGTKSRRNIPGKTEKGPYAPNQRV 468 PL P G+ P + P V H P++++K F K + +PG ++K + Sbjct: 155 PLGEKPGGDDVPVVTTMPAPHSVEDHKPEEEEK-KGFMDKIKEKLPGHSKKPEDSQVVNT 213 Query: 469 TPNVKVIRP 495 TP V+ P Sbjct: 214 TPLVETATP 222 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,435,734 Number of Sequences: 28952 Number of extensions: 314589 Number of successful extensions: 841 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 818 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 841 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1438152744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -