BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11c09 (785 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A5E5K1 Cluster: Putative uncharacterized protein; n=1; ... 34 3.5 UniRef50_A2DQ50 Cluster: Putative uncharacterized protein; n=1; ... 34 4.6 >UniRef50_A5E5K1 Cluster: Putative uncharacterized protein; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 521 Score = 34.3 bits (75), Expect = 3.5 Identities = 22/76 (28%), Positives = 41/76 (53%) Frame = +1 Query: 394 IQSGQSVLFSSTAEFLLQNMKKFPMEVSLWSKEENLAFIGATFIPWDPMFLSYLEKIYNC 573 I +G+ +F + AEFL K P V + K+ ++ ++ A+++P P+F IY+ Sbjct: 302 IFNGKGAMFKNGAEFL-----KLPQVVDVL-KDNSIIYLNASYVPQIPIF------IYHS 349 Query: 574 QEPPPVTLKEEYNVFE 621 P V +K+ Y V++ Sbjct: 350 SFDPIVPIKDVYTVYD 365 >UniRef50_A2DQ50 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 255 Score = 33.9 bits (74), Expect = 4.6 Identities = 21/65 (32%), Positives = 31/65 (47%) Frame = -3 Query: 261 CYMHLFRIFEFERKYICKITPNNQMSAFNQTLYTFDDNLE*KHGIANGHFLNTLKWVYTF 82 CY++ + R +CK P+N +S TLY F DN I+N + L +Y+F Sbjct: 137 CYIYSNYLTSLTRTTVCKCAPDNYISD-PDTLYIFYDNFFESCNISNNYM--GLYLIYSF 193 Query: 81 LHYNF 67 NF Sbjct: 194 EDINF 198 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 684,298,238 Number of Sequences: 1657284 Number of extensions: 12928407 Number of successful extensions: 33332 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 32249 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33326 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 66673674990 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -